SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319225.Plut_1954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319225.Plut_1954
Domain Number 1 Region: 243-507
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.5e-59
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 2 Region: 20-230
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000000000017
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.027
Further Details:      
 
Domain Number 3 Region: 521-622
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000243
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319225.Plut_1954
Sequence length 627
Comment (Chlorobium luteolum DSM 273)
Sequence
MTDTKTTTRQVNVTSKTSVTVLFAGDSGDGMQLTGTQFANTVAVYGSDLNTFPNFPSEIR
APAGTISGVSGFQMQFGSTAVYTPGAKFDVLIAMNAAALKSNIDKLHHGGIIITDTDGFD
AKNLKLSGYGEGNSPLEDGSLQDYTLFEIPVVSLTRAALADTGLSVKNIDRCKNMFILGI
LYWLYSLPIDTTVKTLQTKFKNKADIAEANIKAVQAGYNFGDETDMFAQFGRFEVGPAAM
KKGTYRRVTGNEAAAIGLAAASKKAGLKLFLGSYPITPATEILQALANMKKWGVKTFQAE
DEIAGVLSSIGASYGGALAATSTSGPGLALKSEALGLAVIMELPLVVMNVQRGGPSTGLP
TKPEQSDLFIAMYGRHGDAPMPVIAAYSPVDCFYAAYEAAKIAVEHMTPVICLTDGYLAF
SSEPMLIPSPDSLLEVKPVFAKPRNEGDDPYLPYKRNQLGVREWAVPGTKGLEHRVGGLE
KANETGNVSHDPLNHQLMTDLRMEKVARIADCIPLQTIDNGAEKGDLLVLGWGSTYGAIK
IAVDRALKAGHSVAHAHLRYLNPFPKNLGEILRNYKKVLIPENNCGQLLLMIRDQFLIEP
VAFNKVEGLPFNEMEIEAKITDIVKEL
Download sequence
Identical sequences Q3B1I5
gi|78187796|ref|YP_375839.1| 319225.Plut_1954 WP_011358666.1.73161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]