SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_1118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31964.CMS_1118
Domain Number - Region: 78-134
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00144
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_1118
Sequence length 143
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MIVFVVVGAVGLLLLLSSVALGAALAIYGVGGLLADQAGIGSGGAIAIAVALALVALVVV
QLTVRFVAKQESGGSYSPVGMVGVVTSPTSPTGGEVRLKHIRELERRLAMSPEPLAVGTR
IRVVSEDGFRVRVEPDADAAPTT
Download sequence
Identical sequences B0RGH7
31964.CMS_1118 WP_012298518.1.12855 WP_012298518.1.13751 WP_012298518.1.33835 gi|170781528|ref|YP_001709860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]