SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_2583 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31964.CMS_2583
Domain Number 1 Region: 74-291
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-50
Family D-glucarate dehydratase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_2583
Sequence length 327
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MLPALDDLLATARVVALPLRTRFRGLDVREAVLIEGPLGWTEFSPFTEYDDAESAAWLVA
AFDFGWTAPPAPLRDHVLVNATIPAVEASRVAEVLARFPGCRTAKVKVAERGTTLADDVT
RVAEVRRLLGPEGRVRIDANAAWNVDEAEHAIHALAEHDLEYAEQPCASVEELAELRGRI
RHLGVPIAADESVRKADDPLRVARAGAADLLVIKAQPLGGIHRALRITRDAGLPVVVSSA
LDTSVGISMAAHLAAAIPELPHDCGLGTVSLFVEDVVAEPLVPVDGRIPVRRVTPDASLL
DAHAADADRRAWWLDRIRRTHAVLARA
Download sequence
Identical sequences B0RI92
31964.CMS_2583 gi|170782903|ref|YP_001711237.1| WP_012299847.1.12855 WP_012299847.1.13751 WP_012299847.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]