SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_3096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31964.CMS_3096
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 4.58e-23
Family Ribosomal protein L9 C-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily L9 N-domain-like 7.5e-16
Family Ribosomal protein L9 N-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_3096
Sequence length 150
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MSKVILTTEVSGLGSPGDVVEVKNGFSRNYLVPQGFAVIWSRGGEKQIEQIKAARAAREH
ATIEEAQDLKSRLEAKIVKLTVKAGQGGRLFGSVKTSDIAKAVEESGIGQVDKRKIEIPN
PIKGTGNHEATIRLRDDIVATISLQVVAAK
Download sequence
Identical sequences B0RDN5
gi|170783384|ref|YP_001711718.1| 31964.CMS_3096 WP_012300302.1.12855 WP_012300302.1.13751 WP_012300302.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]