SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319701.M28_Spy0272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  319701.M28_Spy0272
Domain Number - Region: 11-39,151-225
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0133
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319701.M28_Spy0272
Sequence length 298
Comment (Streptococcus pyogenes MGAS6180)
Sequence
MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVLALVIGVIYATSMIFQ
STSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIEDPSLNAFATGSSPQNA
AVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALASAVTVISSIGGRMLWYG
GGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAISRQREYLADASSVELTRNP
QGMINALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSLFSTHPPIEERIERLKNM
Download sequence
Identical sequences Q48V70
319701.M28_Spy0272 gi|71902938|ref|YP_279741.1| WP_011284515.1.1526 WP_011284515.1.31038 WP_011284515.1.58327 WP_011284515.1.61350 WP_011284515.1.68302 WP_011284515.1.7902 WP_011284515.1.81017 WP_011284515.1.94718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]