SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0004
Domain Number 1 Region: 136-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.77e-130
Family Enolase 0.0000000131
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.24e-55
Family Enolase N-terminal domain-like 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0004
Sequence length 422
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MNIEKVIAREVLDSRGNPTVEAEVFLDSGFSGRAIVPSGASTGTHEALELRDGDGRYGGK
GVLRAVQNVNEVLAPALVGLDASEQGAVDAAMLALDGTPNKGRLGGNAILAVSLATARAA
ANELGVPLYRYLGGSNAKTLPVPMMNVINGGAHADNNVDFQEFMVMPVGAPTFREALRYG
AETFHALKKVLAGRGYNTNVGDEGGFAPDLKSNEEALEVLLEAIEKAGYEPGKDIAIALD
PATTELYRDGQYHLESEGRSLSTAEMVDFWADWVSRYPIVSIEDGLAEDDWDGWRLLTER
LGDRVQLVGDDLFVTNPERLARGIETGVGNAILVKVNQIGTLTESMDAIELAKRSRYGTI
ISHRSGESEDAFIADLAVATNAGQIKTGSASRSDRIAKYNQLLRIEDGLGDRAVYLGRRA
LR
Download sequence
Identical sequences Q1J2H6
319795.Dgeo_0004 WP_011529155.1.71355 gi|94984113|ref|YP_603477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]