SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0444
Domain Number 1 Region: 144-205
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000262
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0444
Sequence length 211
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MAFAPFILFRAHGSSPQRSRLSPRTRSKEDTLKMDIYLLCLIVGGGLLVLSLLGGHHGDL
SGHGLDHGMDTDHPDAGDLASWFSLRALVSFAAFFGLAGVMGGLAGLSGPGRLVVALVTG
LAVGALTAFAFRLARSRGEVGAAAGRLVGRTGKVLVPPAPGRPGKVVLTVAGQIEHLLAR
SDDPLRAGDAVIVIGTKGGVLDVKAWEGREA
Download sequence
Identical sequences Q1J187
gi|94984552|ref|YP_603916.1| WP_011529590.1.71355 319795.Dgeo_0444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]