SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_1679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_1679
Domain Number 1 Region: 131-345
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-46
Family D-glucarate dehydratase-like 0.00043
Further Details:      
 
Domain Number 2 Region: 6-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.22e-24
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_1679
Sequence length 362
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MSGPRVARVEGLPYRLPLRGTLAWGAQSALNAAEHVLVRVTLEDGTVGVAEATPRPTIYG
ETPQSVVAILRHLEPALRGLEITDETALNRVRNSVANNNTARGALDMALWDARARAQGLT
LWDTLLGPHGRVRVSFILGIDTPAGMLAEAERVVAAGVRCLKVKVGRDHARDLAVIAELR
RAFGKDVQLYADSNETLTPELAPAALAAMREAGLTYVEEPLPVRDLKARAHLHAQASLPI
VADDSCFTPADLTRELAFDTFDILNVKTARNGFTDGLTMLRTAAAHGKRAMVGSQASTGL
GTLHAALLSTQAEVTEPCELSFVLKLHDDLLDRPITFQDGFLEVSALRDCRLDPAKLARY
QL
Download sequence
Identical sequences Q1IXR0
319795.Dgeo_1679 WP_011530806.1.71355 gi|94985779|ref|YP_605143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]