SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320372.BURPS1710b_A0636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  320372.BURPS1710b_A0636
Domain Number - Region: 7-47,109-125
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0262
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number - Region: 63-132
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.0305
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320372.BURPS1710b_A0636
Sequence length 150
Comment (Burkholderia pseudomallei 1710b)
Sequence
MEHGYEHRRRRRLIRWIQALALSALLAIGVTWIGAAVDHPVERAIVDGMAAPECAQVRAM
PAGSLLSARQPDSAVCRSFFLYRAAYVDAASNAPGYSAAVMRARVDEFWQLVGYVLALWF
VFVCVVVGIVVVVRRRFEQHAGGHHGSTPT
Download sequence
Identical sequences A0A069BE68 A0A0E1S716 A0A0E1TNW4 A0A0E1UEX2 A0A0E1VZ93 A0A0F6G2L6 A0A0F6L0C7 A0A0H3I0R2 A0A290YFY9 A0A2K3FFA9 A0A2K3GEY9 A0A2K3HLC9 A0A2K3IC68 A2S1H6 A3P776 C4B2T8 C4I770 Q3JKV7 Q63JX9
gi|386865376|ref|YP_006278324.1| gi|526459042|ref|YP_008328714.1| gi|403523412|ref|YP_006658981.1| gi|76818447|ref|YP_335796.1| gi|124382592|ref|YP_001025797.1| gi|53722608|ref|YP_111593.1| WP_004198842.1.10047 WP_004198842.1.100583 WP_004198842.1.100720 WP_004198842.1.100727 WP_004198842.1.100825 WP_004198842.1.100900 WP_004198842.1.1010 WP_004198842.1.101381 WP_004198842.1.101559 WP_004198842.1.101588 WP_004198842.1.101783 WP_004198842.1.102051 WP_004198842.1.10290 WP_004198842.1.10359 WP_004198842.1.10553 WP_004198842.1.10633 WP_004198842.1.10746 WP_004198842.1.10907 WP_004198842.1.11046 WP_004198842.1.11072 WP_004198842.1.11404 WP_004198842.1.11893 WP_004198842.1.11998 WP_004198842.1.12731 WP_004198842.1.12856 WP_004198842.1.12860 WP_004198842.1.13198 WP_004198842.1.13520 WP_004198842.1.13597 WP_004198842.1.13603 WP_004198842.1.13639 WP_004198842.1.13925 WP_004198842.1.14356 WP_004198842.1.14539 WP_004198842.1.14557 WP_004198842.1.14660 WP_004198842.1.15170 WP_004198842.1.15364 WP_004198842.1.15525 WP_004198842.1.15696 WP_004198842.1.16249 WP_004198842.1.16358 WP_004198842.1.16540 WP_004198842.1.16561 WP_004198842.1.16625 WP_004198842.1.16680 WP_004198842.1.16689 WP_004198842.1.16749 WP_004198842.1.17068 WP_004198842.1.17278 WP_004198842.1.17748 WP_004198842.1.17786 WP_004198842.1.18396 WP_004198842.1.18405 WP_004198842.1.18471 WP_004198842.1.18669 WP_004198842.1.18704 WP_004198842.1.18744 WP_004198842.1.18868 WP_004198842.1.18906 WP_004198842.1.19401 WP_004198842.1.19486 WP_004198842.1.19629 WP_004198842.1.1976 WP_004198842.1.19815 WP_004198842.1.19842 WP_004198842.1.20021 WP_004198842.1.20246 WP_004198842.1.20501 WP_004198842.1.20520 WP_004198842.1.20531 WP_004198842.1.21147 WP_004198842.1.21205 WP_004198842.1.21291 WP_004198842.1.21304 WP_004198842.1.21442 WP_004198842.1.21461 WP_004198842.1.21809 WP_004198842.1.21907 WP_004198842.1.22046 WP_004198842.1.22299 WP_004198842.1.22308 WP_004198842.1.22329 WP_004198842.1.2261 WP_004198842.1.22625 WP_004198842.1.22779 WP_004198842.1.23009 WP_004198842.1.23086 WP_004198842.1.23104 WP_004198842.1.2317 WP_004198842.1.23385 WP_004198842.1.23852 WP_004198842.1.2404 WP_004198842.1.24134 WP_004198842.1.24314 WP_004198842.1.24372 WP_004198842.1.24454 WP_004198842.1.24701 WP_004198842.1.25068 WP_004198842.1.25102 WP_004198842.1.25138 WP_004198842.1.25265 WP_004198842.1.25628 WP_004198842.1.25728 WP_004198842.1.259 WP_004198842.1.26054 WP_004198842.1.26445 WP_004198842.1.26502 WP_004198842.1.26535 WP_004198842.1.26633 WP_004198842.1.26645 WP_004198842.1.267 WP_004198842.1.26838 WP_004198842.1.26849 WP_004198842.1.27064 WP_004198842.1.27069 WP_004198842.1.27363 WP_004198842.1.27390 WP_004198842.1.27399 WP_004198842.1.27420 WP_004198842.1.27441 WP_004198842.1.27597 WP_004198842.1.2767 WP_004198842.1.28018 WP_004198842.1.28066 WP_004198842.1.28453 WP_004198842.1.28594 WP_004198842.1.28619 WP_004198842.1.28632 WP_004198842.1.29148 WP_004198842.1.29335 WP_004198842.1.29405 WP_004198842.1.29508 WP_004198842.1.29520 WP_004198842.1.29547 WP_004198842.1.29658 WP_004198842.1.29878 WP_004198842.1.29887 WP_004198842.1.29899 WP_004198842.1.29948 WP_004198842.1.30311 WP_004198842.1.30382 WP_004198842.1.3041 WP_004198842.1.30671 WP_004198842.1.3069 WP_004198842.1.30729 WP_004198842.1.31343 WP_004198842.1.31723 WP_004198842.1.31831 WP_004198842.1.32182 WP_004198842.1.32221 WP_004198842.1.3251 WP_004198842.1.3273 WP_004198842.1.32951 WP_004198842.1.33077 WP_004198842.1.33087 WP_004198842.1.33157 WP_004198842.1.33158 WP_004198842.1.33165 WP_004198842.1.332 WP_004198842.1.33366 WP_004198842.1.33419 WP_004198842.1.33543 WP_004198842.1.33573 WP_004198842.1.33779 WP_004198842.1.34230 WP_004198842.1.34393 WP_004198842.1.34747 WP_004198842.1.35025 WP_004198842.1.35052 WP_004198842.1.35090 WP_004198842.1.35141 WP_004198842.1.35227 WP_004198842.1.35249 WP_004198842.1.35474 WP_004198842.1.35485 WP_004198842.1.35491 WP_004198842.1.35757 WP_004198842.1.35825 WP_004198842.1.36106 WP_004198842.1.36174 WP_004198842.1.36259 WP_004198842.1.36527 WP_004198842.1.366 WP_004198842.1.36666 WP_004198842.1.3706 WP_004198842.1.37373 WP_004198842.1.37428 WP_004198842.1.37517 WP_004198842.1.37519 WP_004198842.1.37581 WP_004198842.1.37622 WP_004198842.1.37627 WP_004198842.1.37690 WP_004198842.1.37702 WP_004198842.1.37725 WP_004198842.1.37806 WP_004198842.1.38115 WP_004198842.1.38442 WP_004198842.1.38490 WP_004198842.1.3872 WP_004198842.1.38946 WP_004198842.1.39078 WP_004198842.1.39162 WP_004198842.1.39179 WP_004198842.1.39349 WP_004198842.1.3947 WP_004198842.1.39595 WP_004198842.1.39757 WP_004198842.1.40021 WP_004198842.1.40045 WP_004198842.1.40191 WP_004198842.1.40235 WP_004198842.1.40275 WP_004198842.1.40388 WP_004198842.1.40390 WP_004198842.1.4077 WP_004198842.1.41477 WP_004198842.1.42408 WP_004198842.1.42492 WP_004198842.1.42496 WP_004198842.1.43136 WP_004198842.1.43156 WP_004198842.1.43373 WP_004198842.1.43542 WP_004198842.1.43581 WP_004198842.1.43587 WP_004198842.1.43727 WP_004198842.1.43786 WP_004198842.1.43899 WP_004198842.1.44179 WP_004198842.1.44234 WP_004198842.1.44352 WP_004198842.1.44414 WP_004198842.1.44540 WP_004198842.1.44824 WP_004198842.1.45284 WP_004198842.1.45348 WP_004198842.1.45537 WP_004198842.1.45715 WP_004198842.1.45890 WP_004198842.1.4631 WP_004198842.1.46575 WP_004198842.1.46757 WP_004198842.1.4693 WP_004198842.1.47086 WP_004198842.1.4718 WP_004198842.1.47564 WP_004198842.1.48093 WP_004198842.1.4810 WP_004198842.1.48165 WP_004198842.1.48313 WP_004198842.1.48407 WP_004198842.1.48464 WP_004198842.1.49026 WP_004198842.1.49717 WP_004198842.1.49872 WP_004198842.1.50174 WP_004198842.1.50336 WP_004198842.1.50788 WP_004198842.1.50839 WP_004198842.1.51606 WP_004198842.1.51666 WP_004198842.1.5173 WP_004198842.1.51874 WP_004198842.1.51891 WP_004198842.1.52229 WP_004198842.1.52365 WP_004198842.1.52407 WP_004198842.1.52451 WP_004198842.1.52643 WP_004198842.1.52731 WP_004198842.1.52760 WP_004198842.1.5292 WP_004198842.1.53048 WP_004198842.1.53132 WP_004198842.1.5338 WP_004198842.1.53506 WP_004198842.1.53578 WP_004198842.1.53977 WP_004198842.1.54016 WP_004198842.1.5413 WP_004198842.1.54312 WP_004198842.1.54369 WP_004198842.1.54804 WP_004198842.1.54859 WP_004198842.1.54892 WP_004198842.1.55415 WP_004198842.1.55691 WP_004198842.1.55755 WP_004198842.1.55974 WP_004198842.1.55996 WP_004198842.1.56248 WP_004198842.1.5641 WP_004198842.1.56458 WP_004198842.1.56591 WP_004198842.1.56949 WP_004198842.1.56993 WP_004198842.1.57096 WP_004198842.1.57247 WP_004198842.1.5734 WP_004198842.1.57341 WP_004198842.1.57359 WP_004198842.1.5776 WP_004198842.1.58190 WP_004198842.1.58355 WP_004198842.1.58405 WP_004198842.1.58509 WP_004198842.1.58578 WP_004198842.1.5883 WP_004198842.1.59103 WP_004198842.1.59200 WP_004198842.1.59255 WP_004198842.1.59422 WP_004198842.1.59519 WP_004198842.1.59536 WP_004198842.1.59549 WP_004198842.1.59747 WP_004198842.1.60398 WP_004198842.1.60769 WP_004198842.1.60810 WP_004198842.1.60833 WP_004198842.1.60969 WP_004198842.1.61073 WP_004198842.1.61084 WP_004198842.1.61202 WP_004198842.1.61455 WP_004198842.1.61588 WP_004198842.1.61723 WP_004198842.1.61854 WP_004198842.1.6186 WP_004198842.1.61900 WP_004198842.1.62103 WP_004198842.1.62183 WP_004198842.1.63097 WP_004198842.1.63361 WP_004198842.1.63379 WP_004198842.1.63439 WP_004198842.1.63505 WP_004198842.1.63661 WP_004198842.1.63942 WP_004198842.1.64096 WP_004198842.1.64166 WP_004198842.1.64204 WP_004198842.1.64364 WP_004198842.1.64383 WP_004198842.1.64683 WP_004198842.1.64892 WP_004198842.1.65270 WP_004198842.1.65468 WP_004198842.1.65832 WP_004198842.1.65994 WP_004198842.1.66321 WP_004198842.1.66380 WP_004198842.1.66594 WP_004198842.1.67013 WP_004198842.1.67117 WP_004198842.1.67182 WP_004198842.1.67229 WP_004198842.1.67393 WP_004198842.1.67559 WP_004198842.1.6765 WP_004198842.1.67860 WP_004198842.1.67914 WP_004198842.1.67978 WP_004198842.1.6835 WP_004198842.1.68664 WP_004198842.1.68886 WP_004198842.1.68922 WP_004198842.1.69022 WP_004198842.1.69081 WP_004198842.1.69094 WP_004198842.1.69106 WP_004198842.1.69508 WP_004198842.1.69770 WP_004198842.1.69918 WP_004198842.1.70016 WP_004198842.1.7006 WP_004198842.1.70066 WP_004198842.1.70278 WP_004198842.1.70280 WP_004198842.1.70735 WP_004198842.1.71444 WP_004198842.1.71564 WP_004198842.1.71901 WP_004198842.1.72015 WP_004198842.1.72545 WP_004198842.1.72798 WP_004198842.1.72817 WP_004198842.1.73317 WP_004198842.1.73418 WP_004198842.1.73521 WP_004198842.1.73576 WP_004198842.1.73974 WP_004198842.1.74425 WP_004198842.1.74569 WP_004198842.1.74675 WP_004198842.1.74690 WP_004198842.1.75001 WP_004198842.1.75075 WP_004198842.1.75230 WP_004198842.1.75519 WP_004198842.1.75677 WP_004198842.1.75711 WP_004198842.1.75861 WP_004198842.1.75883 WP_004198842.1.75913 WP_004198842.1.75937 WP_004198842.1.76142 WP_004198842.1.76290 WP_004198842.1.76432 WP_004198842.1.76522 WP_004198842.1.766 WP_004198842.1.7703 WP_004198842.1.77249 WP_004198842.1.77287 WP_004198842.1.77319 WP_004198842.1.77689 WP_004198842.1.77788 WP_004198842.1.77845 WP_004198842.1.78557 WP_004198842.1.78628 WP_004198842.1.78759 WP_004198842.1.78827 WP_004198842.1.79052 WP_004198842.1.795 WP_004198842.1.79653 WP_004198842.1.79689 WP_004198842.1.79710 WP_004198842.1.79725 WP_004198842.1.79782 WP_004198842.1.80098 WP_004198842.1.80302 WP_004198842.1.80395 WP_004198842.1.80433 WP_004198842.1.80614 WP_004198842.1.80923 WP_004198842.1.81042 WP_004198842.1.81479 WP_004198842.1.81511 WP_004198842.1.81543 WP_004198842.1.81665 WP_004198842.1.82283 WP_004198842.1.82323 WP_004198842.1.82394 WP_004198842.1.82575 WP_004198842.1.82694 WP_004198842.1.82727 WP_004198842.1.82915 WP_004198842.1.82950 WP_004198842.1.83080 WP_004198842.1.83357 WP_004198842.1.8341 WP_004198842.1.83487 WP_004198842.1.83543 WP_004198842.1.83609 WP_004198842.1.83688 WP_004198842.1.8388 WP_004198842.1.8390 WP_004198842.1.8395 WP_004198842.1.83967 WP_004198842.1.84002 WP_004198842.1.84026 WP_004198842.1.84379 WP_004198842.1.84480 WP_004198842.1.84654 WP_004198842.1.84866 WP_004198842.1.85170 WP_004198842.1.85412 WP_004198842.1.85467 WP_004198842.1.85490 WP_004198842.1.85565 WP_004198842.1.856 WP_004198842.1.85641 WP_004198842.1.85645 WP_004198842.1.85774 WP_004198842.1.8585 WP_004198842.1.8629 WP_004198842.1.86295 WP_004198842.1.86438 WP_004198842.1.86525 WP_004198842.1.86806 WP_004198842.1.87114 WP_004198842.1.87278 WP_004198842.1.87324 WP_004198842.1.87553 WP_004198842.1.87652 WP_004198842.1.87759 WP_004198842.1.87811 WP_004198842.1.88117 WP_004198842.1.88237 WP_004198842.1.88322 WP_004198842.1.88369 WP_004198842.1.88666 WP_004198842.1.88682 WP_004198842.1.88764 WP_004198842.1.88920 WP_004198842.1.89093 WP_004198842.1.8912 WP_004198842.1.89240 WP_004198842.1.89435 WP_004198842.1.89514 WP_004198842.1.89782 WP_004198842.1.90079 WP_004198842.1.90471 WP_004198842.1.9079 WP_004198842.1.90934 WP_004198842.1.91025 WP_004198842.1.91142 WP_004198842.1.91198 WP_004198842.1.91700 WP_004198842.1.91709 WP_004198842.1.91823 WP_004198842.1.92095 WP_004198842.1.9236 WP_004198842.1.92406 WP_004198842.1.92430 WP_004198842.1.9280 WP_004198842.1.92904 WP_004198842.1.93844 WP_004198842.1.93845 WP_004198842.1.94023 WP_004198842.1.94117 WP_004198842.1.94121 WP_004198842.1.94520 WP_004198842.1.94901 WP_004198842.1.94926 WP_004198842.1.95054 WP_004198842.1.95300 WP_004198842.1.95339 WP_004198842.1.9537 WP_004198842.1.95420 WP_004198842.1.95587 WP_004198842.1.95644 WP_004198842.1.95672 WP_004198842.1.95938 WP_004198842.1.95952 WP_004198842.1.96660 WP_004198842.1.97058 WP_004198842.1.97112 WP_004198842.1.97148 WP_004198842.1.97989 WP_004198842.1.98066 WP_004198842.1.98218 WP_004198842.1.98316 WP_004198842.1.98491 WP_004198842.1.98547 WP_004198842.1.98688 WP_004198842.1.98713 WP_004198842.1.98753 WP_004198842.1.98768 WP_004198842.1.99061 WP_004198842.1.99069 WP_004198842.1.99160 WP_004198842.1.99233 WP_004198842.1.99290 WP_004198842.1.9962 WP_004198842.1.99629 WP_004198842.1.99741 WP_004198842.1.9983 WP_004198842.1.99890 YP_111593.1.59693 gi|126456423|ref|YP_001076186.1| 272560.BPSS1585 320372.BURPS1710b_A0636 357348.BURPS1106A_A2153 412022.BMA10229_2001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]