SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320372.BURPS1710b_A2176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320372.BURPS1710b_A2176
Domain Number 1 Region: 104-290
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.92e-23
Family Biotin dependent carboxylase carboxyltransferase domain 0.036
Further Details:      
 
Domain Number 2 Region: 509-547
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000017
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320372.BURPS1710b_A2176
Sequence length 560
Comment (Burkholderia pseudomallei 1710b)
Sequence
MARDEPRRLPRRRARRARGRFALSPETAYSLSTGRTPFPRPGCGAAPCGRAPPADTAMPM
PRSSPRPPPARGKLPARLARAAVLIGLLLACAAVAGAAAAARAPIVVIPVAGAIGPASAD
FVVRGLERAAREHAPLAIVQLDTPGGLDTSMRQIIKAIVASGVPVAAFVAPGGARAASAG
TYIVYASHVAAMAPGTNLGAASPVQLGIGGQAPAGGRREPAGAPGAAGAGATDTESIETR
KALHDAAAYIRGLAQLRGRNAEWAERAVREAVSLPANDALAQHVVDLLANDPADLAAKLD
GRTIVTATGAHRLDTAQAPLETLEPDWRSRLLATIADPSVALVLVTLGMYGLFFEFANPG
FVLPGVAGAISLLVGLFALQLLPISYAGLALVLLGIAFLIAETFLPTFGALGVGGIVAFA
IGALMLIDTDVPGYGVPWPVIASLAAAGAILVFGVSGFALRARRRPVVTGAEAIVGSIGE
VLDDGLVPDQPPQIGPSADPGAPLAPSAAGWARVHGERWRVASATPIAAGRRVRVTGRNG
LTLTVAPLYDNVVPPRGEPP
Download sequence
Identical sequences Q3JGH6
gi|76818292|ref|YP_337327.1| 320372.BURPS1710b_A2176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]