SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_0376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_0376
Domain Number 1 Region: 145-310
Classification Level Classification E-value
Superfamily E set domains 1.68e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000308
Further Details:      
 
Domain Number 2 Region: 47-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.64e-26
Family Voltage-gated potassium channels 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_0376
Sequence length 333
Comment (Burkholderia pseudomallei 668)
Sequence
MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSW
PVFFASLAALFVVNNTLFALLYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQT
VYAHAIATLEIFVGMSGIALSTGLVFARFARPRAKIMFARHAIVRPFNGRMTLMVRAANA
RQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDY
TRFNDTEPVEPPGAAPDAQAFAAKPGEGDARPV
Download sequence
Identical sequences A0A0F6GAH1 A0A0F6L5K9 A0A2K3FIY3 A0A2K3GG80 A0A2K3HQT7 A0A2K3IG99 A3N508 A3NQQ7 A8E8S7 B1HGI7 H7C748 P83698
WP_004534169.1.100195 WP_004534169.1.10047 WP_004534169.1.100583 WP_004534169.1.100825 WP_004534169.1.100900 WP_004534169.1.1010 WP_004534169.1.101060 WP_004534169.1.101381 WP_004534169.1.101559 WP_004534169.1.101588 WP_004534169.1.101783 WP_004534169.1.10269 WP_004534169.1.10907 WP_004534169.1.1098 WP_004534169.1.11046 WP_004534169.1.11072 WP_004534169.1.11160 WP_004534169.1.11268 WP_004534169.1.11825 WP_004534169.1.11893 WP_004534169.1.11996 WP_004534169.1.1266 WP_004534169.1.12731 WP_004534169.1.12793 WP_004534169.1.12856 WP_004534169.1.12860 WP_004534169.1.13309 WP_004534169.1.13504 WP_004534169.1.13520 WP_004534169.1.13597 WP_004534169.1.13639 WP_004534169.1.1465 WP_004534169.1.14660 WP_004534169.1.15170 WP_004534169.1.15673 WP_004534169.1.16113 WP_004534169.1.16249 WP_004534169.1.16358 WP_004534169.1.16540 WP_004534169.1.16680 WP_004534169.1.16689 WP_004534169.1.16749 WP_004534169.1.17068 WP_004534169.1.17278 WP_004534169.1.17473 WP_004534169.1.17786 WP_004534169.1.18396 WP_004534169.1.18405 WP_004534169.1.18704 WP_004534169.1.18744 WP_004534169.1.18906 WP_004534169.1.19629 WP_004534169.1.1976 WP_004534169.1.20021 WP_004534169.1.20246 WP_004534169.1.20501 WP_004534169.1.20520 WP_004534169.1.21291 WP_004534169.1.21304 WP_004534169.1.21409 WP_004534169.1.21461 WP_004534169.1.21907 WP_004534169.1.22046 WP_004534169.1.22299 WP_004534169.1.2317 WP_004534169.1.23743 WP_004534169.1.23852 WP_004534169.1.23994 WP_004534169.1.24020 WP_004534169.1.2404 WP_004534169.1.24134 WP_004534169.1.24314 WP_004534169.1.24372 WP_004534169.1.24513 WP_004534169.1.24701 WP_004534169.1.25068 WP_004534169.1.25102 WP_004534169.1.25412 WP_004534169.1.25628 WP_004534169.1.259 WP_004534169.1.26054 WP_004534169.1.26502 WP_004534169.1.26565 WP_004534169.1.26633 WP_004534169.1.267 WP_004534169.1.26838 WP_004534169.1.26849 WP_004534169.1.27064 WP_004534169.1.27069 WP_004534169.1.27146 WP_004534169.1.27363 WP_004534169.1.27399 WP_004534169.1.27420 WP_004534169.1.27441 WP_004534169.1.27597 WP_004534169.1.27810 WP_004534169.1.27909 WP_004534169.1.28018 WP_004534169.1.28187 WP_004534169.1.28594 WP_004534169.1.28619 WP_004534169.1.29161 WP_004534169.1.29335 WP_004534169.1.29405 WP_004534169.1.29508 WP_004534169.1.29520 WP_004534169.1.29853 WP_004534169.1.29887 WP_004534169.1.29948 WP_004534169.1.30311 WP_004534169.1.30671 WP_004534169.1.3069 WP_004534169.1.30937 WP_004534169.1.30966 WP_004534169.1.31343 WP_004534169.1.32174 WP_004534169.1.32182 WP_004534169.1.32221 WP_004534169.1.324 WP_004534169.1.3273 WP_004534169.1.32951 WP_004534169.1.33077 WP_004534169.1.33130 WP_004534169.1.33157 WP_004534169.1.332 WP_004534169.1.33366 WP_004534169.1.33573 WP_004534169.1.33779 WP_004534169.1.34230 WP_004534169.1.34333 WP_004534169.1.34393 WP_004534169.1.34564 WP_004534169.1.35090 WP_004534169.1.35227 WP_004534169.1.35249 WP_004534169.1.35485 WP_004534169.1.35491 WP_004534169.1.36106 WP_004534169.1.36174 WP_004534169.1.36259 WP_004534169.1.366 WP_004534169.1.36662 WP_004534169.1.36944 WP_004534169.1.37 WP_004534169.1.3706 WP_004534169.1.37373 WP_004534169.1.37428 WP_004534169.1.37519 WP_004534169.1.37535 WP_004534169.1.37581 WP_004534169.1.37622 WP_004534169.1.37627 WP_004534169.1.37690 WP_004534169.1.37725 WP_004534169.1.37934 WP_004534169.1.37959 WP_004534169.1.37994 WP_004534169.1.38115 WP_004534169.1.38442 WP_004534169.1.38490 WP_004534169.1.38683 WP_004534169.1.3872 WP_004534169.1.38810 WP_004534169.1.39078 WP_004534169.1.39162 WP_004534169.1.39179 WP_004534169.1.3947 WP_004534169.1.39595 WP_004534169.1.39757 WP_004534169.1.39898 WP_004534169.1.40021 WP_004534169.1.40275 WP_004534169.1.40388 WP_004534169.1.40448 WP_004534169.1.4077 WP_004534169.1.41588 WP_004534169.1.41945 WP_004534169.1.42408 WP_004534169.1.42492 WP_004534169.1.42496 WP_004534169.1.43136 WP_004534169.1.43156 WP_004534169.1.43373 WP_004534169.1.43587 WP_004534169.1.43727 WP_004534169.1.43786 WP_004534169.1.44179 WP_004534169.1.44234 WP_004534169.1.44824 WP_004534169.1.45284 WP_004534169.1.45356 WP_004534169.1.45537 WP_004534169.1.45715 WP_004534169.1.4631 WP_004534169.1.46575 WP_004534169.1.46757 WP_004534169.1.46829 WP_004534169.1.46969 WP_004534169.1.47086 WP_004534169.1.47149 WP_004534169.1.48093 WP_004534169.1.48464 WP_004534169.1.49872 WP_004534169.1.50174 WP_004534169.1.50320 WP_004534169.1.50839 WP_004534169.1.51606 WP_004534169.1.5173 WP_004534169.1.5182 WP_004534169.1.52229 WP_004534169.1.52407 WP_004534169.1.52451 WP_004534169.1.52521 WP_004534169.1.52547 WP_004534169.1.52643 WP_004534169.1.52655 WP_004534169.1.52882 WP_004534169.1.5292 WP_004534169.1.53034 WP_004534169.1.53048 WP_004534169.1.53103 WP_004534169.1.53282 WP_004534169.1.53386 WP_004534169.1.53578 WP_004534169.1.54016 WP_004534169.1.54312 WP_004534169.1.54369 WP_004534169.1.54804 WP_004534169.1.54859 WP_004534169.1.55038 WP_004534169.1.5608 WP_004534169.1.56126 WP_004534169.1.56451 WP_004534169.1.56744 WP_004534169.1.57046 WP_004534169.1.57096 WP_004534169.1.57247 WP_004534169.1.57359 WP_004534169.1.58003 WP_004534169.1.58105 WP_004534169.1.58190 WP_004534169.1.58355 WP_004534169.1.58362 WP_004534169.1.58390 WP_004534169.1.58405 WP_004534169.1.58509 WP_004534169.1.58578 WP_004534169.1.58758 WP_004534169.1.59103 WP_004534169.1.59200 WP_004534169.1.59255 WP_004534169.1.59422 WP_004534169.1.59496 WP_004534169.1.59519 WP_004534169.1.59747 WP_004534169.1.60810 WP_004534169.1.60833 WP_004534169.1.60969 WP_004534169.1.61084 WP_004534169.1.61202 WP_004534169.1.61685 WP_004534169.1.63097 WP_004534169.1.63261 WP_004534169.1.63379 WP_004534169.1.63719 WP_004534169.1.64068 WP_004534169.1.64096 WP_004534169.1.64364 WP_004534169.1.64542 WP_004534169.1.64683 WP_004534169.1.64892 WP_004534169.1.65093 WP_004534169.1.65270 WP_004534169.1.65468 WP_004534169.1.65832 WP_004534169.1.65994 WP_004534169.1.66257 WP_004534169.1.66465 WP_004534169.1.67860 WP_004534169.1.67914 WP_004534169.1.6835 WP_004534169.1.68353 WP_004534169.1.68515 WP_004534169.1.68664 WP_004534169.1.68886 WP_004534169.1.68922 WP_004534169.1.69022 WP_004534169.1.69094 WP_004534169.1.69106 WP_004534169.1.69217 WP_004534169.1.69337 WP_004534169.1.69770 WP_004534169.1.70016 WP_004534169.1.70096 WP_004534169.1.70278 WP_004534169.1.71392 WP_004534169.1.71901 WP_004534169.1.72015 WP_004534169.1.72083 WP_004534169.1.72817 WP_004534169.1.73418 WP_004534169.1.73521 WP_004534169.1.73576 WP_004534169.1.73906 WP_004534169.1.73974 WP_004534169.1.74425 WP_004534169.1.74569 WP_004534169.1.75001 WP_004534169.1.75027 WP_004534169.1.75075 WP_004534169.1.75677 WP_004534169.1.75711 WP_004534169.1.75776 WP_004534169.1.75913 WP_004534169.1.76142 WP_004534169.1.76522 WP_004534169.1.76575 WP_004534169.1.766 WP_004534169.1.7703 WP_004534169.1.77319 WP_004534169.1.77689 WP_004534169.1.77788 WP_004534169.1.78029 WP_004534169.1.78278 WP_004534169.1.78759 WP_004534169.1.79360 WP_004534169.1.79710 WP_004534169.1.79725 WP_004534169.1.79782 WP_004534169.1.80395 WP_004534169.1.80433 WP_004534169.1.80614 WP_004534169.1.81042 WP_004534169.1.8126 WP_004534169.1.81479 WP_004534169.1.82197 WP_004534169.1.82394 WP_004534169.1.82506 WP_004534169.1.82727 WP_004534169.1.83080 WP_004534169.1.83357 WP_004534169.1.8341 WP_004534169.1.83487 WP_004534169.1.83543 WP_004534169.1.83688 WP_004534169.1.8390 WP_004534169.1.84026 WP_004534169.1.84181 WP_004534169.1.84375 WP_004534169.1.84379 WP_004534169.1.84654 WP_004534169.1.85412 WP_004534169.1.85565 WP_004534169.1.85584 WP_004534169.1.856 WP_004534169.1.85645 WP_004534169.1.85774 WP_004534169.1.8585 WP_004534169.1.8629 WP_004534169.1.86438 WP_004534169.1.86525 WP_004534169.1.86806 WP_004534169.1.86872 WP_004534169.1.8697 WP_004534169.1.87278 WP_004534169.1.87652 WP_004534169.1.87759 WP_004534169.1.87811 WP_004534169.1.88003 WP_004534169.1.88117 WP_004534169.1.88168 WP_004534169.1.88237 WP_004534169.1.88369 WP_004534169.1.88666 WP_004534169.1.88682 WP_004534169.1.88764 WP_004534169.1.89240 WP_004534169.1.89435 WP_004534169.1.89514 WP_004534169.1.89782 WP_004534169.1.90471 WP_004534169.1.90934 WP_004534169.1.91025 WP_004534169.1.91142 WP_004534169.1.91763 WP_004534169.1.92367 WP_004534169.1.92406 WP_004534169.1.92493 WP_004534169.1.94117 WP_004534169.1.94121 WP_004534169.1.94286 WP_004534169.1.94520 WP_004534169.1.9479 WP_004534169.1.95672 WP_004534169.1.95938 WP_004534169.1.96381 WP_004534169.1.97989 WP_004534169.1.98316 WP_004534169.1.98547 WP_004534169.1.98713 WP_004534169.1.98753 WP_004534169.1.98768 WP_004534169.1.98944 WP_004534169.1.99061 WP_004534169.1.99069 WP_004534169.1.9962 WP_004534169.1.9975 WP_004534169.1.99890 YP_106981.1.59693 1p7bA gi|126439480|ref|YP_001057429.1| 272560.BPSL0355 320373.BURPS668_0376 357348.BURPS1106A_0395 1p7b_A 1p7b_B 2wll_B gi|126453918|ref|YP_001064678.1| gi|53717995|ref|YP_106981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]