SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_0740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_0740
Domain Number 1 Region: 95-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.02e-77
Family D-glucarate dehydratase-like 0.0000597
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.63e-33
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_0740
Sequence length 382
Comment (Burkholderia pseudomallei 668)
Sequence
MKITRLETFVVPPRWLFLKIETDAGIVGWGEPIVEGRAHTVEAAVHELADYLVGQDPLRI
EDHWQVMYRAGFYRGGPITMSAIAGIDQALWDIKGKHHGAPVHALLGGPVRERIKVYSWI
GGDRPSDVANNARAVVERGFQAVKMNGSEELQIVDTFDKVDKVIANVAAVRDAVGPYVGI
GVDFHGRVHKPMAKVLARELDPYKLMFIEEPVLSENAEALRDIANQTSTPIALGERLYSR
WDFKRILEGGYVDIVQPDASHAGGITECRKIATLAECYDVALALHCPLGPIALAACLQLD
AVSYNAFIQEQSLGIHYNQGSDLLDYLRNPDVFRYADGFVAIPQGPGLGIDVDEDKVREM
AKTGHRWRNPVWRHADGSVAEW
Download sequence
Identical sequences A3N621
320373.BURPS668_0740 gi|126442264|ref|YP_001057792.1| WP_011851114.1.32581 WP_011851114.1.37959 WP_011851114.1.45356 WP_011851114.1.52882 WP_011851114.1.58639 WP_011851114.1.59496 WP_011851114.1.68664 WP_011851114.1.69337 WP_011851114.1.75001 WP_011851114.1.78759 WP_011851114.1.99061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]