SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_0799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_0799
Domain Number 1 Region: 117-360
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-66
Family D-glucarate dehydratase-like 0.00000431
Further Details:      
 
Domain Number 2 Region: 8-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.23e-23
Family Enolase N-terminal domain-like 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_0799
Sequence length 361
Comment (Burkholderia pseudomallei 668)
Sequence
MSSALTFRELKATAVRLPMSNPIRTASGLIADAPFVLIDLHTEQGVTGHAYLFVFTPIVL
KPLATLIASFGELLEGKRLAPLDTRDLLESQFHLVGNTGLVSMAVAGVEMALWDAHARAL
GVPLVRALGGAPQPVPAYSSIGMLGVDASCRLAEQSLARGFRAMKIKIGYVTLEQDLEVV
RAVKSVLGEQSMLCVDYNQGLTLDEAIRRCRALDEFGLGWIEEPTRQNDYAGHARIARET
LTPIQMGENCFGTSELAQCIAAGASDLLMFDLMKIGGVSRWLHGAALAEAASLSVSTHNY
QEFSAHLMAVTPTAHWLQYYDYADAVLAEPMRIVDGNALPSETPGSGVEWNPAALARYRI
A
Download sequence
Identical sequences A0A0F6GEX7 A0A1S0SR91 A3N680 B1HFF9
gi|126438652|ref|YP_001057851.1| 320373.BURPS668_0799 WP_004522725.1.100720 WP_004522725.1.101060 WP_004522725.1.101307 WP_004522725.1.10290 WP_004522725.1.10746 WP_004522725.1.11160 WP_004522725.1.11268 WP_004522725.1.11747 WP_004522725.1.11998 WP_004522725.1.1266 WP_004522725.1.13198 WP_004522725.1.13950 WP_004522725.1.14356 WP_004522725.1.14557 WP_004522725.1.1465 WP_004522725.1.15170 WP_004522725.1.15364 WP_004522725.1.15525 WP_004522725.1.15696 WP_004522725.1.16090 WP_004522725.1.16113 WP_004522725.1.16358 WP_004522725.1.18471 WP_004522725.1.18669 WP_004522725.1.18868 WP_004522725.1.19401 WP_004522725.1.19815 WP_004522725.1.19842 WP_004522725.1.19854 WP_004522725.1.20501 WP_004522725.1.20673 WP_004522725.1.21147 WP_004522725.1.21205 WP_004522725.1.21409 WP_004522725.1.22308 WP_004522725.1.23009 WP_004522725.1.24020 WP_004522725.1.2404 WP_004522725.1.24513 WP_004522725.1.2462 WP_004522725.1.25138 WP_004522725.1.25628 WP_004522725.1.25728 WP_004522725.1.26565 WP_004522725.1.27146 WP_004522725.1.27441 WP_004522725.1.2767 WP_004522725.1.27810 WP_004522725.1.28066 WP_004522725.1.28187 WP_004522725.1.28632 WP_004522725.1.29547 WP_004522725.1.29658 WP_004522725.1.29899 WP_004522725.1.33087 WP_004522725.1.33130 WP_004522725.1.33165 WP_004522725.1.34333 WP_004522725.1.35249 WP_004522725.1.35474 WP_004522725.1.36662 WP_004522725.1.36944 WP_004522725.1.37535 WP_004522725.1.37702 WP_004522725.1.37806 WP_004522725.1.37994 WP_004522725.1.40045 WP_004522725.1.40426 WP_004522725.1.40448 WP_004522725.1.43678 WP_004522725.1.44179 WP_004522725.1.44414 WP_004522725.1.45356 WP_004522725.1.45890 WP_004522725.1.4718 WP_004522725.1.49717 WP_004522725.1.50788 WP_004522725.1.5105 WP_004522725.1.51902 WP_004522725.1.52407 WP_004522725.1.52731 WP_004522725.1.52760 WP_004522725.1.52882 WP_004522725.1.53034 WP_004522725.1.53103 WP_004522725.1.5338 WP_004522725.1.54312 WP_004522725.1.55415 WP_004522725.1.5641 WP_004522725.1.56458 WP_004522725.1.56949 WP_004522725.1.5734 WP_004522725.1.57341 WP_004522725.1.5883 WP_004522725.1.59536 WP_004522725.1.60769 WP_004522725.1.60836 WP_004522725.1.61685 WP_004522725.1.61723 WP_004522725.1.61854 WP_004522725.1.6186 WP_004522725.1.61900 WP_004522725.1.62103 WP_004522725.1.63361 WP_004522725.1.63661 WP_004522725.1.63942 WP_004522725.1.64204 WP_004522725.1.65093 WP_004522725.1.65270 WP_004522725.1.66321 WP_004522725.1.67013 WP_004522725.1.67117 WP_004522725.1.67229 WP_004522725.1.67559 WP_004522725.1.67978 WP_004522725.1.69918 WP_004522725.1.7006 WP_004522725.1.70066 WP_004522725.1.70735 WP_004522725.1.71444 WP_004522725.1.71564 WP_004522725.1.73906 WP_004522725.1.73974 WP_004522725.1.74177 WP_004522725.1.74690 WP_004522725.1.75937 WP_004522725.1.76432 WP_004522725.1.77249 WP_004522725.1.78506 WP_004522725.1.78628 WP_004522725.1.78759 WP_004522725.1.795 WP_004522725.1.80302 WP_004522725.1.80923 WP_004522725.1.81543 WP_004522725.1.82575 WP_004522725.1.82950 WP_004522725.1.83609 WP_004522725.1.8395 WP_004522725.1.84375 WP_004522725.1.85443 WP_004522725.1.86295 WP_004522725.1.8697 WP_004522725.1.87324 WP_004522725.1.87553 WP_004522725.1.90934 WP_004522725.1.91142 WP_004522725.1.91700 WP_004522725.1.92430 WP_004522725.1.92904 WP_004522725.1.93844 WP_004522725.1.94403 WP_004522725.1.94498 WP_004522725.1.94901 WP_004522725.1.95054 WP_004522725.1.95300 WP_004522725.1.9537 WP_004522725.1.95587 WP_004522725.1.95644 WP_004522725.1.95938 WP_004522725.1.97112 WP_004522725.1.98218 WP_004522725.1.98491 WP_004522725.1.98713 WP_004522725.1.99160 WP_004522725.1.99629 WP_004522725.1.99890 WP_004522725.1.99919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]