SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_1789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_1789
Domain Number 1 Region: 450-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_1789
Sequence length 570
Comment (Burkholderia pseudomallei 668)
Sequence
MDLRSKHIDAPPQHAAHFAPLDEPPAPRARRTALDALAGLSIAGLLIPEAVAYAGLANLP
PQAGLIALVVGLVVYAIAGSSRFAIVSATSSSAVVLAATVMSEAGPGAAAQLMLAAALVA
TTGILFILAGAARLGGMSDFIARPVLRGFTFGLALTIVIKQLPKMLDVPIHHGDTLRVAL
DLLLGIAGCNVRSAALGATALAILFALGRRTRVPATLVVIVLGIAAGYWIDWHRYGIAVV
GTIDLQNLAFGMPVLGRSGWMQTAEFGFALMLILYAESYGSIRNFALKHGDTVSPNRDLV
ALGCANLVSGLLHGMPVGAGYSATSANEAAGAQTRMAGLFAAAVIALIAWLLLPQLARIP
EPVLAAIVIFAVSHSLHPEVFRPYWTWHRDRIVVIAALAAVIVLGVLHGLLAAIGVSLLL
TLRQLSEPNVSVLGRLRGSHDFVDVSMHEDAKPIPGVLIVRPEAQLFFANAERVLTMARR
LARDAQPPVHTVMLSLEESPDVDGTTIEALKTFGAECDARGWRLALVRLKPNVLRVLQRA
ADGGLRADALSELSVDESLQSLTAGELPRA
Download sequence
Identical sequences A0A095UB95 A0A0E1UMS0 A0A0F6GFG5 A0A0H2WEM5 A0A290Y8S7 A2S2H6 A3N907 A3NUQ8 C4B0D9
gi|124385946|ref|YP_001026145.1| 243160.BMA1270 320373.BURPS668_1789 320388.BMASAVP1_A1758 320389.BMA10247_1029 357348.BURPS1106A_1810 412022.BMA10229_A0137 WP_004192099.1.100104 WP_004192099.1.10047 WP_004192099.1.100583 WP_004192099.1.100727 WP_004192099.1.100825 WP_004192099.1.101060 WP_004192099.1.102051 WP_004192099.1.10290 WP_004192099.1.10553 WP_004192099.1.10633 WP_004192099.1.10746 WP_004192099.1.10907 WP_004192099.1.1098 WP_004192099.1.11046 WP_004192099.1.11160 WP_004192099.1.11268 WP_004192099.1.11404 WP_004192099.1.11747 WP_004192099.1.11996 WP_004192099.1.1266 WP_004192099.1.12793 WP_004192099.1.12856 WP_004192099.1.13198 WP_004192099.1.13309 WP_004192099.1.13504 WP_004192099.1.13603 WP_004192099.1.13639 WP_004192099.1.13925 WP_004192099.1.14356 WP_004192099.1.14557 WP_004192099.1.1465 WP_004192099.1.15696 WP_004192099.1.16113 WP_004192099.1.16249 WP_004192099.1.16358 WP_004192099.1.16540 WP_004192099.1.16561 WP_004192099.1.16689 WP_004192099.1.17067 WP_004192099.1.17473 WP_004192099.1.17786 WP_004192099.1.18058 WP_004192099.1.18396 WP_004192099.1.18471 WP_004192099.1.18549 WP_004192099.1.18669 WP_004192099.1.18704 WP_004192099.1.18868 WP_004192099.1.19401 WP_004192099.1.19486 WP_004192099.1.19540 WP_004192099.1.19629 WP_004192099.1.19842 WP_004192099.1.19854 WP_004192099.1.20501 WP_004192099.1.20531 WP_004192099.1.20673 WP_004192099.1.21291 WP_004192099.1.21304 WP_004192099.1.21442 WP_004192099.1.21461 WP_004192099.1.21653 WP_004192099.1.21809 WP_004192099.1.21907 WP_004192099.1.22308 WP_004192099.1.22329 WP_004192099.1.2261 WP_004192099.1.22625 WP_004192099.1.23009 WP_004192099.1.23086 WP_004192099.1.23104 WP_004192099.1.2317 WP_004192099.1.23385 WP_004192099.1.23852 WP_004192099.1.23994 WP_004192099.1.24020 WP_004192099.1.2404 WP_004192099.1.24372 WP_004192099.1.24454 WP_004192099.1.24513 WP_004192099.1.2462 WP_004192099.1.25102 WP_004192099.1.25138 WP_004192099.1.25412 WP_004192099.1.25728 WP_004192099.1.26054 WP_004192099.1.26445 WP_004192099.1.26535 WP_004192099.1.26565 WP_004192099.1.26645 WP_004192099.1.26838 WP_004192099.1.27069 WP_004192099.1.27146 WP_004192099.1.27363 WP_004192099.1.27441 WP_004192099.1.2767 WP_004192099.1.27810 WP_004192099.1.28066 WP_004192099.1.28187 WP_004192099.1.28453 WP_004192099.1.28594 WP_004192099.1.28632 WP_004192099.1.29148 WP_004192099.1.29161 WP_004192099.1.29178 WP_004192099.1.29335 WP_004192099.1.29405 WP_004192099.1.29853 WP_004192099.1.29878 WP_004192099.1.29887 WP_004192099.1.29948 WP_004192099.1.30382 WP_004192099.1.3041 WP_004192099.1.30671 WP_004192099.1.30729 WP_004192099.1.30937 WP_004192099.1.30966 WP_004192099.1.31723 WP_004192099.1.31831 WP_004192099.1.32174 WP_004192099.1.324 WP_004192099.1.3251 WP_004192099.1.32581 WP_004192099.1.32951 WP_004192099.1.33077 WP_004192099.1.33087 WP_004192099.1.33130 WP_004192099.1.33157 WP_004192099.1.33158 WP_004192099.1.33165 WP_004192099.1.33419 WP_004192099.1.33493 WP_004192099.1.33543 WP_004192099.1.34333 WP_004192099.1.34747 WP_004192099.1.35025 WP_004192099.1.35227 WP_004192099.1.35491 WP_004192099.1.35757 WP_004192099.1.35825 WP_004192099.1.35878 WP_004192099.1.36174 WP_004192099.1.36527 WP_004192099.1.36662 WP_004192099.1.36666 WP_004192099.1.36944 WP_004192099.1.37373 WP_004192099.1.37446 WP_004192099.1.37517 WP_004192099.1.37535 WP_004192099.1.37627 WP_004192099.1.37690 WP_004192099.1.37702 WP_004192099.1.37806 WP_004192099.1.37934 WP_004192099.1.37994 WP_004192099.1.38115 WP_004192099.1.38490 WP_004192099.1.38683 WP_004192099.1.3872 WP_004192099.1.38946 WP_004192099.1.39078 WP_004192099.1.39162 WP_004192099.1.39179 WP_004192099.1.39349 WP_004192099.1.39757 WP_004192099.1.39898 WP_004192099.1.40021 WP_004192099.1.40045 WP_004192099.1.40191 WP_004192099.1.40235 WP_004192099.1.40390 WP_004192099.1.40426 WP_004192099.1.40448 WP_004192099.1.4077 WP_004192099.1.41477 WP_004192099.1.41588 WP_004192099.1.42408 WP_004192099.1.42492 WP_004192099.1.42496 WP_004192099.1.42800 WP_004192099.1.43136 WP_004192099.1.43542 WP_004192099.1.43727 WP_004192099.1.43786 WP_004192099.1.43899 WP_004192099.1.44352 WP_004192099.1.44540 WP_004192099.1.44824 WP_004192099.1.45356 WP_004192099.1.45890 WP_004192099.1.46575 WP_004192099.1.46757 WP_004192099.1.46829 WP_004192099.1.4693 WP_004192099.1.46969 WP_004192099.1.47086 WP_004192099.1.47149 WP_004192099.1.4718 WP_004192099.1.47564 WP_004192099.1.4810 WP_004192099.1.48313 WP_004192099.1.48407 WP_004192099.1.49026 WP_004192099.1.50320 WP_004192099.1.50336 WP_004192099.1.50788 WP_004192099.1.5105 WP_004192099.1.51666 WP_004192099.1.5173 WP_004192099.1.51874 WP_004192099.1.51891 WP_004192099.1.51902 WP_004192099.1.52229 WP_004192099.1.52365 WP_004192099.1.52407 WP_004192099.1.52521 WP_004192099.1.52643 WP_004192099.1.52760 WP_004192099.1.52882 WP_004192099.1.5292 WP_004192099.1.53034 WP_004192099.1.53048 WP_004192099.1.53103 WP_004192099.1.53282 WP_004192099.1.53578 WP_004192099.1.53977 WP_004192099.1.54016 WP_004192099.1.5413 WP_004192099.1.54312 WP_004192099.1.54369 WP_004192099.1.54859 WP_004192099.1.54892 WP_004192099.1.55415 WP_004192099.1.55974 WP_004192099.1.55996 WP_004192099.1.5608 WP_004192099.1.56126 WP_004192099.1.56248 WP_004192099.1.56451 WP_004192099.1.56458 WP_004192099.1.56949 WP_004192099.1.56993 WP_004192099.1.57096 WP_004192099.1.57247 WP_004192099.1.5734 WP_004192099.1.57359 WP_004192099.1.57679 WP_004192099.1.58003 WP_004192099.1.58190 WP_004192099.1.58355 WP_004192099.1.58362 WP_004192099.1.58390 WP_004192099.1.58509 WP_004192099.1.58578 WP_004192099.1.58639 WP_004192099.1.5883 WP_004192099.1.59103 WP_004192099.1.59422 WP_004192099.1.59496 WP_004192099.1.59519 WP_004192099.1.59536 WP_004192099.1.59549 WP_004192099.1.60398 WP_004192099.1.60769 WP_004192099.1.60810 WP_004192099.1.60833 WP_004192099.1.60836 WP_004192099.1.60969 WP_004192099.1.61073 WP_004192099.1.61084 WP_004192099.1.61455 WP_004192099.1.61588 WP_004192099.1.61685 WP_004192099.1.61854 WP_004192099.1.61900 WP_004192099.1.62103 WP_004192099.1.62183 WP_004192099.1.62774 WP_004192099.1.63097 WP_004192099.1.63361 WP_004192099.1.63661 WP_004192099.1.63719 WP_004192099.1.64096 WP_004192099.1.64166 WP_004192099.1.64204 WP_004192099.1.64364 WP_004192099.1.64683 WP_004192099.1.64892 WP_004192099.1.65093 WP_004192099.1.65270 WP_004192099.1.65832 WP_004192099.1.66257 WP_004192099.1.66465 WP_004192099.1.66594 WP_004192099.1.67013 WP_004192099.1.67182 WP_004192099.1.67229 WP_004192099.1.67393 WP_004192099.1.67860 WP_004192099.1.67909 WP_004192099.1.67978 WP_004192099.1.68515 WP_004192099.1.68664 WP_004192099.1.68922 WP_004192099.1.69169 WP_004192099.1.69337 WP_004192099.1.69508 WP_004192099.1.69918 WP_004192099.1.70016 WP_004192099.1.70278 WP_004192099.1.70735 WP_004192099.1.71392 WP_004192099.1.71901 WP_004192099.1.72015 WP_004192099.1.72083 WP_004192099.1.72545 WP_004192099.1.72798 WP_004192099.1.72817 WP_004192099.1.73317 WP_004192099.1.73906 WP_004192099.1.74425 WP_004192099.1.7450 WP_004192099.1.74675 WP_004192099.1.75001 WP_004192099.1.75027 WP_004192099.1.75075 WP_004192099.1.75230 WP_004192099.1.75276 WP_004192099.1.75708 WP_004192099.1.75711 WP_004192099.1.75776 WP_004192099.1.75861 WP_004192099.1.75883 WP_004192099.1.76142 WP_004192099.1.76432 WP_004192099.1.766 WP_004192099.1.7703 WP_004192099.1.77287 WP_004192099.1.77689 WP_004192099.1.78029 WP_004192099.1.78557 WP_004192099.1.78759 WP_004192099.1.78807 WP_004192099.1.78827 WP_004192099.1.795 WP_004192099.1.79653 WP_004192099.1.79689 WP_004192099.1.79725 WP_004192099.1.80098 WP_004192099.1.80433 WP_004192099.1.81042 WP_004192099.1.81543 WP_004192099.1.81665 WP_004192099.1.82197 WP_004192099.1.82283 WP_004192099.1.82323 WP_004192099.1.82394 WP_004192099.1.82575 WP_004192099.1.82694 WP_004192099.1.82915 WP_004192099.1.82950 WP_004192099.1.83357 WP_004192099.1.8341 WP_004192099.1.83543 WP_004192099.1.83688 WP_004192099.1.8388 WP_004192099.1.8390 WP_004192099.1.8395 WP_004192099.1.84026 WP_004192099.1.84063 WP_004192099.1.84375 WP_004192099.1.84480 WP_004192099.1.84654 WP_004192099.1.85170 WP_004192099.1.85412 WP_004192099.1.85584 WP_004192099.1.85641 WP_004192099.1.8585 WP_004192099.1.86295 WP_004192099.1.86438 WP_004192099.1.86525 WP_004192099.1.8697 WP_004192099.1.87114 WP_004192099.1.87278 WP_004192099.1.87553 WP_004192099.1.88237 WP_004192099.1.88322 WP_004192099.1.88411 WP_004192099.1.88682 WP_004192099.1.88920 WP_004192099.1.8912 WP_004192099.1.90079 WP_004192099.1.9079 WP_004192099.1.91025 WP_004192099.1.91700 WP_004192099.1.91709 WP_004192099.1.91823 WP_004192099.1.92095 WP_004192099.1.9236 WP_004192099.1.92367 WP_004192099.1.92507 WP_004192099.1.9280 WP_004192099.1.9281 WP_004192099.1.92904 WP_004192099.1.93844 WP_004192099.1.93845 WP_004192099.1.94023 WP_004192099.1.94050 WP_004192099.1.94286 WP_004192099.1.94403 WP_004192099.1.94498 WP_004192099.1.94926 WP_004192099.1.95054 WP_004192099.1.9537 WP_004192099.1.95420 WP_004192099.1.95672 WP_004192099.1.95938 WP_004192099.1.95952 WP_004192099.1.96660 WP_004192099.1.98066 WP_004192099.1.98218 WP_004192099.1.98547 WP_004192099.1.98713 WP_004192099.1.98753 WP_004192099.1.98768 WP_004192099.1.98944 WP_004192099.1.99061 WP_004192099.1.99233 WP_004192099.1.99290 WP_004192099.1.9962 WP_004192099.1.99741 WP_004192099.1.9975 WP_004192099.1.9983 WP_004192099.1.99919 YP_102939.1.87047 gi|53723491|ref|YP_102939.1| gi|121599111|ref|YP_993078.1| gi|126439369|ref|YP_001058828.1| gi|126451659|ref|YP_001066079.1| gi|403518513|ref|YP_006652646.1| gi|556577239|ref|YP_008745917.1| gi|126450088|ref|YP_001080584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]