SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_A0916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_A0916
Domain Number 1 Region: 47-233
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.96e-23
Family Biotin dependent carboxylase carboxyltransferase domain 0.046
Further Details:      
 
Domain Number 2 Region: 452-490
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000144
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_A0916
Sequence length 503
Comment (Burkholderia pseudomallei 668)
Sequence
MPRSSPRPPPARGKLPARLARAAVLIGLLLACAAAAAAGAAAAARAPIVVIPVAGAIGPA
SADFVVRGLERAAREHAPLAIVQLDTPGGLDTSMRQIIKAIVASGVPVAAFVAPGGARAA
SAGTYIVYASHVAAMAPGTNLGAASPVQLGIGGQAPAGGRREPAGAPGAAGAGATDTEST
ETRKALHDAAAYIRGLAQLRGRNAEWAERAVREAVSLPANDALAQHVVDLLANDPADLAA
KLDGRTIVTATGAHRLDTARAPLETLEPDWRSRLLATIADPSVALVLVTLGMYGLFFEFA
NPGFVLPGVAGAIGLLVGLFALQLLPISYAGLALVLLGIAFLIAETFLPTFGALGVGGIV
AFAIGALMLIDTDVPGYGVPWPVIASLAAAGAILVFGVSGFALRARRRPVVTGAEAIVGS
IGEVLDDGLVPDQPPQIGPSADPGAPLAPSAAGWARVHGERWRVASATPIAAGRRVRVTG
RNGLTLTVAPLYDNVVPPRGEPP
Download sequence
Identical sequences A3NHU4
gi|126442937|ref|YP_001061915.1| WP_011852847.1.45356 WP_011852847.1.52882 320373.BURPS668_A0916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]