SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_A2710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_A2710
Domain Number 1 Region: 119-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.98e-62
Family D-glucarate dehydratase-like 0.000000436
Further Details:      
 
Domain Number 2 Region: 6-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.19e-34
Family Enolase N-terminal domain-like 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_A2710
Sequence length 377
Comment (Burkholderia pseudomallei 668)
Sequence
MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQTLVLVRVRCSDGIEGVGEGTTIGGLA
YGEESPESIKTNIDAYFAPMLRGADASRPGAAMARVRKLFQGNRFAKCALETALFDAHAR
RLGVPLSELLGGRTTDALDVAWTLASGDTARDIAEAEAMLEARRHRAFKLKIGARAVADD
VAHVVAIKRALGERGDVRVDVNQAWTESEAVWAGARLADAGVSLVEQPIAAANRAGLKRL
TALAHIPIMADEALRGPVDAFALARERAADVFAVKIAQSGGLQGAAAVAAIAAAAGIELY
GGTMLEGAAGTIASAQLFSTFGALEWGTELFGPLLLTEEILVEPLRYEDFKLHLPSAPGL
GIAFDWARIERMQRRAR
Download sequence
Identical sequences A3NMY1
WP_011853729.1.45356 WP_011853729.1.52882 320373.BURPS668_A2710 gi|126442507|ref|YP_001063702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]