SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320388.BMASAVP1_A0001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320388.BMASAVP1_A0001
Domain Number 1 Region: 747-994
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 2 Region: 33-217
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.77e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.064
Further Details:      
 
Domain Number 3 Region: 461-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.25e-17
Family Pyruvate oxidase and decarboxylase PP module 0.047
Further Details:      
 
Weak hits

Sequence:  320388.BMASAVP1_A0001
Domain Number - Region: 280-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000303
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.053
Further Details:      
 
Domain Number - Region: 647-705
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00479
Family Ferredoxin domains from multidomain proteins 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320388.BMASAVP1_A0001
Sequence length 1193
Comment (Burkholderia mallei SAVP1)
Sequence
MNAPLDAGQRASLEAALQSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDRAAGLNTA
GFISGYRGSPLGGLDLSLWKAKRHLAAHRIVFQPGINEDLAATAVWGSQQVNLYPGAKYD
GVFSMWYGKGPGVDRTGDVFKHANSAGSAPHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVESSASVDIDPHRTQIVLPTD
FVMPDGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIDSPHARFGIVTGGKA
YLDVRQALVDLGLDDDTCARIGIRLYKVGCVWPLEAQGAQAFARGLDEILVVEEKRQILE
YAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
EKFELPSDVRARIAARIAVIEAKETALAKPHVSAERKPWFCSGCPHNTSTTVPEGSRAIA
GIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDEKHVFANLGDGTYFHSGLLAIRAA
IASKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLAAEGAKRIVIVTDEPRKYDGHT
SQLAPGVTIHHRDQLDDVQRTLREIEGTTILIYDQTCATEKRRRRKRGAYPDPAKRVVIN
EAVCEGCGDCSVQSNCLSVEPRETEFGTKRQINQSTCNKDFSCVKGFCPSFVTVEGGRLR
KPKAVSADASALPPMPEPVLPAIDRAYGVLVTGVGGTGVVTIGALLGMAAHLEGKGVTVL
DVTGLAQKGGAVMSHVQIAHAPADIHATRIAMGEADLVIGCDAIVTAGDECTSRMRHGTT
RVVVNSAQTPTAEFIKNPKWTFPGASAELDIRAAAGDAVDLVDANHFAVALLGDAIYTNP
FVLGYAWQRGWLPLAYASLVRAIELNGVQIEQNRAAFEWGRRAAFDPASVRAAAADDAQA
GATVIALHTKKAVDALIATRVEHLNAYQNAAYAARFSAVVSQARAAERALGADTAQEPLT
EAVARNLCKLMAYKDEYEVARLHAAPAFVAKLAEQFEGDWKLSFHLAPPLFAKKDARGRP
VKQQYGPWLMPVFRVLAKLKFLRGTAFDVFGRTEERRTERALIGEYEALVQELTGSRLTR
DTLPLAVELASLPDGIRGYGHVKENNLRAVRAKWAQLLAQWRSPEGGQTRNVA
Download sequence
Identical sequences A0A0F6GJ78 A0A153KT68 A0A1S0SSK7 A2S7M3
gi|126448000|ref|YP_001083036.1| gi|124385627|ref|YP_001027942.1| 320388.BMASAVP1_A0001 320388.BMASAVP1_A3122 320389.BMA10247_3525 412022.BMA10229_A1972 gi|121598938|ref|YP_991357.1| gi|121599960|ref|YP_994410.1| WP_004202742.1.100104 WP_004202742.1.100720 WP_004202742.1.100727 WP_004202742.1.101307 WP_004202742.1.10553 WP_004202742.1.10633 WP_004202742.1.10746 WP_004202742.1.10907 WP_004202742.1.1098 WP_004202742.1.11404 WP_004202742.1.12731 WP_004202742.1.12856 WP_004202742.1.13639 WP_004202742.1.13925 WP_004202742.1.15364 WP_004202742.1.15525 WP_004202742.1.15696 WP_004202742.1.16561 WP_004202742.1.16689 WP_004202742.1.17067 WP_004202742.1.17748 WP_004202742.1.19486 WP_004202742.1.19842 WP_004202742.1.21147 WP_004202742.1.21205 WP_004202742.1.21442 WP_004202742.1.2261 WP_004202742.1.22625 WP_004202742.1.23104 WP_004202742.1.2404 WP_004202742.1.24454 WP_004202742.1.2462 WP_004202742.1.26445 WP_004202742.1.26535 WP_004202742.1.26645 WP_004202742.1.27069 WP_004202742.1.28453 WP_004202742.1.29148 WP_004202742.1.29335 WP_004202742.1.29547 WP_004202742.1.29658 WP_004202742.1.29853 WP_004202742.1.29878 WP_004202742.1.29887 WP_004202742.1.29899 WP_004202742.1.30729 WP_004202742.1.30966 WP_004202742.1.31831 WP_004202742.1.3251 WP_004202742.1.33157 WP_004202742.1.33165 WP_004202742.1.33419 WP_004202742.1.33543 WP_004202742.1.35474 WP_004202742.1.35757 WP_004202742.1.35825 WP_004202742.1.35878 WP_004202742.1.36527 WP_004202742.1.36666 WP_004202742.1.37690 WP_004202742.1.37702 WP_004202742.1.37959 WP_004202742.1.38490 WP_004202742.1.3872 WP_004202742.1.39162 WP_004202742.1.39179 WP_004202742.1.39349 WP_004202742.1.39757 WP_004202742.1.40191 WP_004202742.1.40390 WP_004202742.1.41477 WP_004202742.1.42408 WP_004202742.1.43136 WP_004202742.1.43542 WP_004202742.1.44352 WP_004202742.1.44414 WP_004202742.1.44540 WP_004202742.1.46757 WP_004202742.1.4693 WP_004202742.1.47564 WP_004202742.1.4810 WP_004202742.1.48165 WP_004202742.1.48407 WP_004202742.1.48464 WP_004202742.1.49717 WP_004202742.1.51666 WP_004202742.1.51874 WP_004202742.1.51891 WP_004202742.1.51902 WP_004202742.1.52229 WP_004202742.1.52365 WP_004202742.1.52643 WP_004202742.1.52731 WP_004202742.1.53048 WP_004202742.1.5338 WP_004202742.1.54016 WP_004202742.1.54859 WP_004202742.1.5608 WP_004202742.1.5641 WP_004202742.1.57247 WP_004202742.1.57341 WP_004202742.1.57679 WP_004202742.1.58390 WP_004202742.1.59422 WP_004202742.1.59549 WP_004202742.1.60769 WP_004202742.1.60810 WP_004202742.1.61073 WP_004202742.1.61084 WP_004202742.1.61455 WP_004202742.1.61588 WP_004202742.1.61723 WP_004202742.1.6186 WP_004202742.1.62183 WP_004202742.1.63261 WP_004202742.1.63942 WP_004202742.1.64166 WP_004202742.1.64383 WP_004202742.1.66465 WP_004202742.1.66594 WP_004202742.1.67013 WP_004202742.1.67117 WP_004202742.1.67229 WP_004202742.1.67559 WP_004202742.1.67860 WP_004202742.1.68664 WP_004202742.1.69508 WP_004202742.1.7006 WP_004202742.1.70066 WP_004202742.1.70280 WP_004202742.1.71444 WP_004202742.1.71564 WP_004202742.1.71901 WP_004202742.1.72015 WP_004202742.1.72545 WP_004202742.1.72798 WP_004202742.1.72817 WP_004202742.1.74177 WP_004202742.1.74425 WP_004202742.1.74675 WP_004202742.1.74690 WP_004202742.1.75230 WP_004202742.1.75711 WP_004202742.1.75861 WP_004202742.1.75937 WP_004202742.1.76142 WP_004202742.1.76432 WP_004202742.1.77249 WP_004202742.1.77287 WP_004202742.1.77689 WP_004202742.1.78628 WP_004202742.1.79689 WP_004202742.1.80302 WP_004202742.1.80433 WP_004202742.1.80923 WP_004202742.1.81511 WP_004202742.1.81543 WP_004202742.1.82394 WP_004202742.1.82915 WP_004202742.1.83357 WP_004202742.1.83543 WP_004202742.1.83609 WP_004202742.1.8390 WP_004202742.1.84026 WP_004202742.1.84063 WP_004202742.1.84480 WP_004202742.1.84654 WP_004202742.1.85412 WP_004202742.1.86525 WP_004202742.1.86806 WP_004202742.1.87278 WP_004202742.1.87324 WP_004202742.1.88322 WP_004202742.1.88920 WP_004202742.1.8912 WP_004202742.1.90079 WP_004202742.1.9079 WP_004202742.1.91025 WP_004202742.1.91198 WP_004202742.1.91823 WP_004202742.1.92095 WP_004202742.1.9236 WP_004202742.1.92430 WP_004202742.1.9281 WP_004202742.1.94023 WP_004202742.1.94498 WP_004202742.1.9479 WP_004202742.1.94901 WP_004202742.1.94926 WP_004202742.1.95054 WP_004202742.1.95300 WP_004202742.1.95339 WP_004202742.1.95420 WP_004202742.1.95587 WP_004202742.1.95644 WP_004202742.1.96660 WP_004202742.1.97112 WP_004202742.1.98066 WP_004202742.1.98218 WP_004202742.1.98547 WP_004202742.1.98768 WP_004202742.1.99160 WP_004202742.1.99233 WP_004202742.1.9962 WP_004202742.1.99629 WP_004202742.1.99741 WP_004202742.1.99890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]