SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 320388.BMASAVP1_A2193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320388.BMASAVP1_A2193
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-127
Family Enolase 0.0000000101
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.3e-55
Family Enolase N-terminal domain-like 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320388.BMASAVP1_A2193
Sequence length 427
Comment (Burkholderia mallei SAVP1)
Sequence
MSAIVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYG
GKGVLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAK
AAAEEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALR
CGAEVFHALKKILGDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLA
LDCAASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWDGWKLLT
ERLGKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRARYT
AVISHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGK
SAFYNLR
Download sequence
Identical sequences A0A069B2U9 A0A0E1SH56 A0A0E1U0S8 A0A0E1UDU5 A0A0E1W222 A0A0F6GD92 A0A0H3HLA6 A0A290Y9W0 A0A2K3EYI6 A0A2K3G3K8 A0A2K3H9H5 A0A2K3HYR7 A1V5K2 A2SAU7 A3ML77 A3NB82 A3NX13 A8EC13 B1HDU1 C4AR34 C4KQJ7 Q3JQQ6 Q62J10 Q63SQ0
gi|126453285|ref|YP_001066884.1| gi|526473221|ref|YP_008343337.1| gi|237812996|ref|YP_002897447.1| gi|386861159|ref|YP_006274108.1| gi|126440215|ref|YP_001059603.1| BupsA.00084.a gi|124383576|ref|YP_001029066.1| gi|403519310|ref|YP_006653444.1| gi|121599921|ref|YP_993505.1| gi|556575685|ref|YP_008745244.1| gi|76811447|ref|YP_334097.1| WP_004192585.1.100104 WP_004192585.1.100195 WP_004192585.1.10047 WP_004192585.1.100583 WP_004192585.1.100720 WP_004192585.1.100727 WP_004192585.1.100825 WP_004192585.1.100900 WP_004192585.1.1010 WP_004192585.1.101060 WP_004192585.1.101307 WP_004192585.1.101381 WP_004192585.1.101559 WP_004192585.1.101588 WP_004192585.1.101783 WP_004192585.1.102051 WP_004192585.1.10269 WP_004192585.1.10290 WP_004192585.1.10359 WP_004192585.1.10553 WP_004192585.1.10633 WP_004192585.1.10746 WP_004192585.1.10907 WP_004192585.1.1098 WP_004192585.1.11046 WP_004192585.1.11072 WP_004192585.1.11160 WP_004192585.1.11268 WP_004192585.1.11404 WP_004192585.1.11747 WP_004192585.1.11825 WP_004192585.1.11893 WP_004192585.1.11998 WP_004192585.1.1266 WP_004192585.1.12731 WP_004192585.1.12793 WP_004192585.1.12856 WP_004192585.1.12860 WP_004192585.1.13198 WP_004192585.1.13520 WP_004192585.1.13597 WP_004192585.1.13603 WP_004192585.1.13639 WP_004192585.1.13925 WP_004192585.1.13950 WP_004192585.1.14356 WP_004192585.1.14539 WP_004192585.1.14557 WP_004192585.1.1465 WP_004192585.1.14660 WP_004192585.1.15170 WP_004192585.1.15364 WP_004192585.1.15525 WP_004192585.1.15673 WP_004192585.1.15696 WP_004192585.1.16090 WP_004192585.1.16113 WP_004192585.1.16249 WP_004192585.1.16358 WP_004192585.1.16561 WP_004192585.1.16625 WP_004192585.1.16680 WP_004192585.1.16689 WP_004192585.1.16749 WP_004192585.1.17067 WP_004192585.1.17068 WP_004192585.1.17278 WP_004192585.1.17748 WP_004192585.1.17786 WP_004192585.1.18058 WP_004192585.1.18396 WP_004192585.1.18405 WP_004192585.1.18471 WP_004192585.1.18549 WP_004192585.1.18631 WP_004192585.1.18669 WP_004192585.1.18704 WP_004192585.1.18744 WP_004192585.1.18868 WP_004192585.1.18906 WP_004192585.1.19401 WP_004192585.1.19486 WP_004192585.1.19540 WP_004192585.1.19629 WP_004192585.1.1976 WP_004192585.1.19815 WP_004192585.1.19842 WP_004192585.1.19854 WP_004192585.1.20021 WP_004192585.1.20246 WP_004192585.1.20501 WP_004192585.1.20520 WP_004192585.1.20531 WP_004192585.1.20673 WP_004192585.1.20954 WP_004192585.1.21147 WP_004192585.1.21205 WP_004192585.1.21291 WP_004192585.1.21304 WP_004192585.1.21409 WP_004192585.1.21442 WP_004192585.1.21461 WP_004192585.1.21653 WP_004192585.1.21809 WP_004192585.1.21907 WP_004192585.1.22046 WP_004192585.1.22299 WP_004192585.1.22308 WP_004192585.1.22329 WP_004192585.1.2261 WP_004192585.1.22625 WP_004192585.1.22779 WP_004192585.1.23009 WP_004192585.1.23086 WP_004192585.1.23104 WP_004192585.1.23131 WP_004192585.1.2317 WP_004192585.1.23385 WP_004192585.1.23743 WP_004192585.1.23852 WP_004192585.1.23994 WP_004192585.1.24020 WP_004192585.1.2404 WP_004192585.1.24134 WP_004192585.1.24314 WP_004192585.1.24372 WP_004192585.1.24454 WP_004192585.1.24513 WP_004192585.1.2462 WP_004192585.1.24701 WP_004192585.1.25068 WP_004192585.1.25102 WP_004192585.1.25138 WP_004192585.1.25265 WP_004192585.1.25628 WP_004192585.1.25728 WP_004192585.1.259 WP_004192585.1.26054 WP_004192585.1.26445 WP_004192585.1.26502 WP_004192585.1.26535 WP_004192585.1.26565 WP_004192585.1.26633 WP_004192585.1.26645 WP_004192585.1.267 WP_004192585.1.26838 WP_004192585.1.26849 WP_004192585.1.27064 WP_004192585.1.27069 WP_004192585.1.27146 WP_004192585.1.27363 WP_004192585.1.27390 WP_004192585.1.27399 WP_004192585.1.27420 WP_004192585.1.27441 WP_004192585.1.27597 WP_004192585.1.2767 WP_004192585.1.27810 WP_004192585.1.27909 WP_004192585.1.28018 WP_004192585.1.28066 WP_004192585.1.28187 WP_004192585.1.28453 WP_004192585.1.28594 WP_004192585.1.28619 WP_004192585.1.28632 WP_004192585.1.29148 WP_004192585.1.29178 WP_004192585.1.29335 WP_004192585.1.29405 WP_004192585.1.29508 WP_004192585.1.29520 WP_004192585.1.29547 WP_004192585.1.29658 WP_004192585.1.29853 WP_004192585.1.29878 WP_004192585.1.29887 WP_004192585.1.29899 WP_004192585.1.29948 WP_004192585.1.30311 WP_004192585.1.30382 WP_004192585.1.3041 WP_004192585.1.30671 WP_004192585.1.3069 WP_004192585.1.30729 WP_004192585.1.30966 WP_004192585.1.31343 WP_004192585.1.31723 WP_004192585.1.31831 WP_004192585.1.32174 WP_004192585.1.32182 WP_004192585.1.32221 WP_004192585.1.3251 WP_004192585.1.32581 WP_004192585.1.3273 WP_004192585.1.32951 WP_004192585.1.33077 WP_004192585.1.33087 WP_004192585.1.33130 WP_004192585.1.33157 WP_004192585.1.33158 WP_004192585.1.33165 WP_004192585.1.332 WP_004192585.1.33366 WP_004192585.1.33419 WP_004192585.1.33543 WP_004192585.1.33573 WP_004192585.1.33779 WP_004192585.1.34230 WP_004192585.1.34393 WP_004192585.1.34564 WP_004192585.1.34747 WP_004192585.1.35025 WP_004192585.1.35052 WP_004192585.1.35090 WP_004192585.1.35141 WP_004192585.1.35227 WP_004192585.1.35249 WP_004192585.1.35474 WP_004192585.1.35485 WP_004192585.1.35491 WP_004192585.1.35757 WP_004192585.1.35825 WP_004192585.1.35878 WP_004192585.1.36106 WP_004192585.1.36174 WP_004192585.1.36259 WP_004192585.1.36527 WP_004192585.1.366 WP_004192585.1.36662 WP_004192585.1.36666 WP_004192585.1.36944 WP_004192585.1.37 WP_004192585.1.3706 WP_004192585.1.37373 WP_004192585.1.37428 WP_004192585.1.37519 WP_004192585.1.37535 WP_004192585.1.37581 WP_004192585.1.37622 WP_004192585.1.37627 WP_004192585.1.37690 WP_004192585.1.37702 WP_004192585.1.37725 WP_004192585.1.37806 WP_004192585.1.37934 WP_004192585.1.37959 WP_004192585.1.37994 WP_004192585.1.38115 WP_004192585.1.38442 WP_004192585.1.38490 WP_004192585.1.3872 WP_004192585.1.38810 WP_004192585.1.38946 WP_004192585.1.39078 WP_004192585.1.39162 WP_004192585.1.39179 WP_004192585.1.39349 WP_004192585.1.3947 WP_004192585.1.39595 WP_004192585.1.39757 WP_004192585.1.40021 WP_004192585.1.40045 WP_004192585.1.40191 WP_004192585.1.40235 WP_004192585.1.40275 WP_004192585.1.40388 WP_004192585.1.40390 WP_004192585.1.40426 WP_004192585.1.40448 WP_004192585.1.4077 WP_004192585.1.41477 WP_004192585.1.41588 WP_004192585.1.41945 WP_004192585.1.42408 WP_004192585.1.42492 WP_004192585.1.42496 WP_004192585.1.42800 WP_004192585.1.43136 WP_004192585.1.43156 WP_004192585.1.43373 WP_004192585.1.43542 WP_004192585.1.43581 WP_004192585.1.43587 WP_004192585.1.43678 WP_004192585.1.43727 WP_004192585.1.43786 WP_004192585.1.43899 WP_004192585.1.44179 WP_004192585.1.44234 WP_004192585.1.44352 WP_004192585.1.44414 WP_004192585.1.44540 WP_004192585.1.44824 WP_004192585.1.45284 WP_004192585.1.45348 WP_004192585.1.45356 WP_004192585.1.45537 WP_004192585.1.45715 WP_004192585.1.45890 WP_004192585.1.4631 WP_004192585.1.46575 WP_004192585.1.46757 WP_004192585.1.4693 WP_004192585.1.46969 WP_004192585.1.47086 WP_004192585.1.4718 WP_004192585.1.47564 WP_004192585.1.48093 WP_004192585.1.4810 WP_004192585.1.48165 WP_004192585.1.48313 WP_004192585.1.48407 WP_004192585.1.48464 WP_004192585.1.49026 WP_004192585.1.49717 WP_004192585.1.49872 WP_004192585.1.50174 WP_004192585.1.50320 WP_004192585.1.50336 WP_004192585.1.50401 WP_004192585.1.50636 WP_004192585.1.50788 WP_004192585.1.50839 WP_004192585.1.5105 WP_004192585.1.51606 WP_004192585.1.51666 WP_004192585.1.5173 WP_004192585.1.5182 WP_004192585.1.51874 WP_004192585.1.51891 WP_004192585.1.51902 WP_004192585.1.52229 WP_004192585.1.52365 WP_004192585.1.52407 WP_004192585.1.52451 WP_004192585.1.52547 WP_004192585.1.52643 WP_004192585.1.52655 WP_004192585.1.52731 WP_004192585.1.52760 WP_004192585.1.52882 WP_004192585.1.5292 WP_004192585.1.53034 WP_004192585.1.53048 WP_004192585.1.53103 WP_004192585.1.53132 WP_004192585.1.5338 WP_004192585.1.53386 WP_004192585.1.53506 WP_004192585.1.53578 WP_004192585.1.53977 WP_004192585.1.54016 WP_004192585.1.5413 WP_004192585.1.54312 WP_004192585.1.54369 WP_004192585.1.54804 WP_004192585.1.54859 WP_004192585.1.54892 WP_004192585.1.55038 WP_004192585.1.55415 WP_004192585.1.55691 WP_004192585.1.55755 WP_004192585.1.55974 WP_004192585.1.55996 WP_004192585.1.5608 WP_004192585.1.56126 WP_004192585.1.56248 WP_004192585.1.5641 WP_004192585.1.56458 WP_004192585.1.56591 WP_004192585.1.56744 WP_004192585.1.56949 WP_004192585.1.56993 WP_004192585.1.57046 WP_004192585.1.57096 WP_004192585.1.57247 WP_004192585.1.5734 WP_004192585.1.57341 WP_004192585.1.57359 WP_004192585.1.57679 WP_004192585.1.5776 WP_004192585.1.58003 WP_004192585.1.58105 WP_004192585.1.58190 WP_004192585.1.58355 WP_004192585.1.58362 WP_004192585.1.58390 WP_004192585.1.58405 WP_004192585.1.58509 WP_004192585.1.58523 WP_004192585.1.58578 WP_004192585.1.58639 WP_004192585.1.58758 WP_004192585.1.5883 WP_004192585.1.59103 WP_004192585.1.59200 WP_004192585.1.59255 WP_004192585.1.59422 WP_004192585.1.59496 WP_004192585.1.59519 WP_004192585.1.59536 WP_004192585.1.59549 WP_004192585.1.59747 WP_004192585.1.60398 WP_004192585.1.60769 WP_004192585.1.60810 WP_004192585.1.60833 WP_004192585.1.60836 WP_004192585.1.60969 WP_004192585.1.61073 WP_004192585.1.61084 WP_004192585.1.61202 WP_004192585.1.61455 WP_004192585.1.61588 WP_004192585.1.61685 WP_004192585.1.61723 WP_004192585.1.61854 WP_004192585.1.6186 WP_004192585.1.61900 WP_004192585.1.62103 WP_004192585.1.62183 WP_004192585.1.63261 WP_004192585.1.63361 WP_004192585.1.63379 WP_004192585.1.63439 WP_004192585.1.63505 WP_004192585.1.63661 WP_004192585.1.63719 WP_004192585.1.63942 WP_004192585.1.64068 WP_004192585.1.64096 WP_004192585.1.64166 WP_004192585.1.64204 WP_004192585.1.64364 WP_004192585.1.64383 WP_004192585.1.64542 WP_004192585.1.64683 WP_004192585.1.64892 WP_004192585.1.65093 WP_004192585.1.65270 WP_004192585.1.65468 WP_004192585.1.65832 WP_004192585.1.65994 WP_004192585.1.66321 WP_004192585.1.66380 WP_004192585.1.66465 WP_004192585.1.66594 WP_004192585.1.67013 WP_004192585.1.67117 WP_004192585.1.67182 WP_004192585.1.67229 WP_004192585.1.67393 WP_004192585.1.67559 WP_004192585.1.6765 WP_004192585.1.67860 WP_004192585.1.67909 WP_004192585.1.67914 WP_004192585.1.67978 WP_004192585.1.6835 WP_004192585.1.68353 WP_004192585.1.68515 WP_004192585.1.68664 WP_004192585.1.68886 WP_004192585.1.68922 WP_004192585.1.69022 WP_004192585.1.69081 WP_004192585.1.69094 WP_004192585.1.69106 WP_004192585.1.69169 WP_004192585.1.69217 WP_004192585.1.69337 WP_004192585.1.69354 WP_004192585.1.69508 WP_004192585.1.69770 WP_004192585.1.69918 WP_004192585.1.70016 WP_004192585.1.7006 WP_004192585.1.70066 WP_004192585.1.70096 WP_004192585.1.70278 WP_004192585.1.70280 WP_004192585.1.70735 WP_004192585.1.71444 WP_004192585.1.71564 WP_004192585.1.71901 WP_004192585.1.72015 WP_004192585.1.72083 WP_004192585.1.72545 WP_004192585.1.72798 WP_004192585.1.72817 WP_004192585.1.73317 WP_004192585.1.73418 WP_004192585.1.73521 WP_004192585.1.73576 WP_004192585.1.73906 WP_004192585.1.73974 WP_004192585.1.74177 WP_004192585.1.74425 WP_004192585.1.7450 WP_004192585.1.74569 WP_004192585.1.74675 WP_004192585.1.74690 WP_004192585.1.75001 WP_004192585.1.75027 WP_004192585.1.75075 WP_004192585.1.75230 WP_004192585.1.75276 WP_004192585.1.75519 WP_004192585.1.75677 WP_004192585.1.75708 WP_004192585.1.75711 WP_004192585.1.75861 WP_004192585.1.75883 WP_004192585.1.75913 WP_004192585.1.75937 WP_004192585.1.76142 WP_004192585.1.76290 WP_004192585.1.76432 WP_004192585.1.76522 WP_004192585.1.76575 WP_004192585.1.766 WP_004192585.1.7703 WP_004192585.1.77249 WP_004192585.1.77287 WP_004192585.1.77319 WP_004192585.1.77689 WP_004192585.1.77788 WP_004192585.1.77845 WP_004192585.1.78029 WP_004192585.1.78278 WP_004192585.1.78506 WP_004192585.1.78557 WP_004192585.1.78628 WP_004192585.1.78759 WP_004192585.1.78807 WP_004192585.1.78827 WP_004192585.1.79052 WP_004192585.1.79360 WP_004192585.1.795 WP_004192585.1.79653 WP_004192585.1.79689 WP_004192585.1.79710 WP_004192585.1.79725 WP_004192585.1.79782 WP_004192585.1.80098 WP_004192585.1.80302 WP_004192585.1.80395 WP_004192585.1.80433 WP_004192585.1.80614 WP_004192585.1.80923 WP_004192585.1.81042 WP_004192585.1.8126 WP_004192585.1.81479 WP_004192585.1.81543 WP_004192585.1.81665 WP_004192585.1.82197 WP_004192585.1.82283 WP_004192585.1.82323 WP_004192585.1.82394 WP_004192585.1.82506 WP_004192585.1.82575 WP_004192585.1.82694 WP_004192585.1.82727 WP_004192585.1.82915 WP_004192585.1.82950 WP_004192585.1.83080 WP_004192585.1.83357 WP_004192585.1.8341 WP_004192585.1.83487 WP_004192585.1.83543 WP_004192585.1.83567 WP_004192585.1.83609 WP_004192585.1.83688 WP_004192585.1.8388 WP_004192585.1.8390 WP_004192585.1.8395 WP_004192585.1.83967 WP_004192585.1.84002 WP_004192585.1.84026 WP_004192585.1.84063 WP_004192585.1.84181 WP_004192585.1.84375 WP_004192585.1.84379 WP_004192585.1.84480 WP_004192585.1.84654 WP_004192585.1.84866 WP_004192585.1.85170 WP_004192585.1.85412 WP_004192585.1.85443 WP_004192585.1.85467 WP_004192585.1.85490 WP_004192585.1.85565 WP_004192585.1.856 WP_004192585.1.85641 WP_004192585.1.85774 WP_004192585.1.8585 WP_004192585.1.8629 WP_004192585.1.86295 WP_004192585.1.86438 WP_004192585.1.86525 WP_004192585.1.86806 WP_004192585.1.86872 WP_004192585.1.8697 WP_004192585.1.87114 WP_004192585.1.87278 WP_004192585.1.87324 WP_004192585.1.87553 WP_004192585.1.87652 WP_004192585.1.87759 WP_004192585.1.87811 WP_004192585.1.88003 WP_004192585.1.88117 WP_004192585.1.88168 WP_004192585.1.88237 WP_004192585.1.88322 WP_004192585.1.88369 WP_004192585.1.88411 WP_004192585.1.88666 WP_004192585.1.88682 WP_004192585.1.88764 WP_004192585.1.88920 WP_004192585.1.89093 WP_004192585.1.8912 WP_004192585.1.89240 WP_004192585.1.89435 WP_004192585.1.89514 WP_004192585.1.89782 WP_004192585.1.90079 WP_004192585.1.90471 WP_004192585.1.9079 WP_004192585.1.90934 WP_004192585.1.91025 WP_004192585.1.91142 WP_004192585.1.91198 WP_004192585.1.91700 WP_004192585.1.91709 WP_004192585.1.91763 WP_004192585.1.91823 WP_004192585.1.92095 WP_004192585.1.9236 WP_004192585.1.92406 WP_004192585.1.92430 WP_004192585.1.92493 WP_004192585.1.92507 WP_004192585.1.9280 WP_004192585.1.9281 WP_004192585.1.92904 WP_004192585.1.93844 WP_004192585.1.93845 WP_004192585.1.94023 WP_004192585.1.94050 WP_004192585.1.94117 WP_004192585.1.94121 WP_004192585.1.94403 WP_004192585.1.94498 WP_004192585.1.94520 WP_004192585.1.9479 WP_004192585.1.94901 WP_004192585.1.94926 WP_004192585.1.95054 WP_004192585.1.95300 WP_004192585.1.95339 WP_004192585.1.9537 WP_004192585.1.95420 WP_004192585.1.95587 WP_004192585.1.95644 WP_004192585.1.95672 WP_004192585.1.95938 WP_004192585.1.95952 WP_004192585.1.96381 WP_004192585.1.96660 WP_004192585.1.97058 WP_004192585.1.97112 WP_004192585.1.97148 WP_004192585.1.97989 WP_004192585.1.98066 WP_004192585.1.98218 WP_004192585.1.98316 WP_004192585.1.98491 WP_004192585.1.98547 WP_004192585.1.98688 WP_004192585.1.98713 WP_004192585.1.98753 WP_004192585.1.98768 WP_004192585.1.98944 WP_004192585.1.99061 WP_004192585.1.99069 WP_004192585.1.99160 WP_004192585.1.99233 WP_004192585.1.99290 WP_004192585.1.9962 WP_004192585.1.99629 WP_004192585.1.99741 WP_004192585.1.9975 WP_004192585.1.9983 WP_004192585.1.99890 WP_004192585.1.99919 YP_103309.1.87047 YP_108866.1.59693 gi|53719880|ref|YP_108866.1| gi|126450209|ref|YP_001081013.1| gi|53723784|ref|YP_103309.1| 243160.BMA1689 272560.BPSL2270 320372.BURPS1710b_2711 320373.BURPS668_2577 320388.BMASAVP1_A2193 320389.BMA10247_1466 357348.BURPS1106A_2631 412022.BMA10229_A3125 536230.GBP346_A2756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]