SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 32049.SYNPCC7002_A2586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  32049.SYNPCC7002_A2586
Domain Number - Region: 97-138
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00248
Family NfeD domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 32049.SYNPCC7002_A2586
Sequence length 145
Comment (Synechococcus PCC 7002)
Sequence
MLNPLMIWLIIGAVLCSLEFIFPTAFMEFMLGLGAVAVAVIVYLVPSLDPNVQIFLWLLF
STIAIVSSRRFFTPKTSIRTISDAADAETLTAIAPGEAGRVLYEGNSWRARCADETVTID
PHQTVYVLRREGTTLIVMPRHLLEP
Download sequence
Identical sequences B1XL76
WP_012308181.1.22074 WP_012308181.1.52632 WP_012308181.1.62705 gi|170079180|ref|YP_001735818.1| 32049.SYNPCC7002_A2586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]