SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32051.SynWH7803_2455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32051.SynWH7803_2455
Domain Number 1 Region: 15-115
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-16
Family cAMP-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 32051.SynWH7803_2455
Sequence length 126
Comment (Synechococcus WH 7803)
Sequence
MPTAVQLIAEHRNHDELILPTGSWLFSRGTFASSIYAIERGLVELTSGGRDRLRYGDGEV
FFFEDLLAERQRHSRTATAITPVHAFSLDRNSFMELIHQHPTLVLTLLGRQHARLREQRL
DAAHFY
Download sequence
Identical sequences A5GPL6
gi|148240791|ref|YP_001226178.1| WP_011934340.1.60914 32051.SynWH7803_2455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]