SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321314.SC1522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321314.SC1522
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.24e-79
Family D-glucarate dehydratase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.87e-34
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 321314.SC1522
Sequence length 404
Comment (Salmonella enterica Choleraesuis)
Sequence
MKIVGAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELPVASYLTDHLCPQLIGRDA
RRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASREGVMVY
CHTTGHTIDDVLEDYARHKEQGFKAIRVQCGVPGMKTTYGMAKGKGLAYEPATKGQWPEE
QLWSTEKYLDFTPKLFDAVRNTFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRLFWMEDP
TPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEFMGYSEQMLEVFPHNWTFE
GGYRHPGDKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Download sequence
Identical sequences Q57PD3
321314.SC1522 AE017220|CDS_1620407-1621621 gi|62180092|ref|YP_216509.1| WP_001539998.1.15468 WP_001539998.1.17758 WP_001539998.1.22270 WP_001539998.1.32493 WP_001539998.1.36948 WP_001539998.1.44943 WP_001539998.1.50497 WP_001539998.1.50777 WP_001539998.1.5527 WP_001539998.1.57902 WP_001539998.1.60486 WP_001539998.1.71418 WP_001539998.1.76162 WP_001539998.1.99426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]