SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321314.SC1645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321314.SC1645
Domain Number 1 Region: 794-1162
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.03e-117
Family PFOR PP module 0.0000000358
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.11e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000119
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-73
Family PFOR Pyr module 0.0000001
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.71e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000225
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-23
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 321314.SC1645
Sequence length 1174
Comment (Salmonella enterica Choleraesuis)
Sequence
MQTIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
GGAIAAVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHRATLKSRVPFIHFFDGFRTSHEINKII
PLTDETILNLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
EAMKAFGDATGRQYQPFEYYGHPQAERVIIMMGSALGTCEEVVDELLIRGEKVGVLKVRL
FRPFSAKHLLQALPETVRAIAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRTI
GGRYGLSSKEFGPACVLAIFNELGRAKPKPRFTVGIYDDVTNLSLPLPENTLPGSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEKPIRSAYL
IAQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEAQAVLKQKKARF
YVVNAAKIARECGLGARINTVMQMAFFHLTHILPGDSALVELQGAIAKSYSSKGQDLVER
NWQALALAQESLAEVPLQAVNPHSAHRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPVWKEELCTQCNHCVAACPHSAIRAKVVSPQAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPQIKAINMMSRLEHVEEE
KVNYDFFLDLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLSVDQHRARVMRL
LAQFADRIPAELNDALHAEATPDVRREQVAALRQHLKSVAGAEELLKDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKPPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWRDAALDLQKRYDFLALLAGKAEKTGAD
Download sequence
Identical sequences Q57P10
AE017220|CDS_1755308-1758832 321314.SC1645 WP_001540115.1.15468 WP_001540115.1.17758 WP_001540115.1.22270 WP_001540115.1.32493 WP_001540115.1.36948 WP_001540115.1.44943 WP_001540115.1.50497 WP_001540115.1.50777 WP_001540115.1.5527 WP_001540115.1.57902 WP_001540115.1.60486 WP_001540115.1.71418 WP_001540115.1.76162 WP_001540115.1.99426 gi|62180215|ref|YP_216632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]