SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321314.SC1775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321314.SC1775
Domain Number 1 Region: 451-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000942
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 321314.SC1775
Sequence length 561
Comment (Salmonella enterica Choleraesuis)
Sequence
MNKLFSSHVMPFRALIDACWKEKYTASRFTRDVIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTSAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLMSGFFLILFG
LARLGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPT
VNIGDAAIGVVTLGTLIFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGNVATIGSQFHYV
LADGTQGNGIPQLLPQLMLPWSLPGSDFTLSWDSLRALLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELIGQGLGNMVAPFFGGITATAAIARSAANVRAGATSPVSAVIHAILV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVNVDVPEDVLVLRVIGPLFFAAAEGLFTDL
ESRIKGKRIVVLKWDAVPVLDAGGLDAFQRFVKRLPEGCELRISNLEFQPLRTMARAGIK
PIPGRLTFFPNRTEALADLLS
Download sequence
Identical sequences A0A0H3BM98 A0A0R9NDB4 A0A1C3A2D7 A0A1S1AIT5 A0A1Z3Q4Y5 A0A271CUA8 A0A2D3TV98 A0A2I6MKS6 C0Q355 Q57NN0 Q8Z698 V1XJS6
gi|62180345|ref|YP_216762.1| gi|194442347|ref|YP_002041033.1| gi|528819577|ref|YP_008360780.1| gi|224583730|ref|YP_002637528.1| gi|29141567|ref|NP_804909.1| NP_456291.1.84458 WP_001037188.1.100002 WP_001037188.1.100008 WP_001037188.1.100036 WP_001037188.1.100079 WP_001037188.1.100137 WP_001037188.1.100196 WP_001037188.1.100284 WP_001037188.1.100288 WP_001037188.1.100313 WP_001037188.1.100314 WP_001037188.1.100321 WP_001037188.1.100354 WP_001037188.1.100421 WP_001037188.1.100432 WP_001037188.1.100446 WP_001037188.1.100450 WP_001037188.1.100472 WP_001037188.1.100502 WP_001037188.1.100521 WP_001037188.1.100592 WP_001037188.1.100610 WP_001037188.1.10065 WP_001037188.1.100711 WP_001037188.1.100714 WP_001037188.1.100732 WP_001037188.1.100733 WP_001037188.1.100739 WP_001037188.1.100764 WP_001037188.1.100799 WP_001037188.1.100886 WP_001037188.1.100941 WP_001037188.1.100953 WP_001037188.1.101011 WP_001037188.1.10108 WP_001037188.1.101185 WP_001037188.1.101226 WP_001037188.1.10124 WP_001037188.1.101271 WP_001037188.1.101312 WP_001037188.1.101322 WP_001037188.1.101374 WP_001037188.1.101520 WP_001037188.1.101609 WP_001037188.1.101612 WP_001037188.1.101616 WP_001037188.1.101741 WP_001037188.1.101744 WP_001037188.1.10177 WP_001037188.1.101776 WP_001037188.1.101868 WP_001037188.1.101890 WP_001037188.1.101941 WP_001037188.1.102050 WP_001037188.1.102087 WP_001037188.1.10276 WP_001037188.1.10338 WP_001037188.1.1038 WP_001037188.1.104 WP_001037188.1.10401 WP_001037188.1.10428 WP_001037188.1.10459 WP_001037188.1.10465 WP_001037188.1.10475 WP_001037188.1.10511 WP_001037188.1.10514 WP_001037188.1.10530 WP_001037188.1.10532 WP_001037188.1.10547 WP_001037188.1.10568 WP_001037188.1.10595 WP_001037188.1.10642 WP_001037188.1.10654 WP_001037188.1.10675 WP_001037188.1.10677 WP_001037188.1.10720 WP_001037188.1.10857 WP_001037188.1.10873 WP_001037188.1.10926 WP_001037188.1.10936 WP_001037188.1.11012 WP_001037188.1.11055 WP_001037188.1.11126 WP_001037188.1.11142 WP_001037188.1.11239 WP_001037188.1.11253 WP_001037188.1.11254 WP_001037188.1.11314 WP_001037188.1.1135 WP_001037188.1.11362 WP_001037188.1.11385 WP_001037188.1.1142 WP_001037188.1.11426 WP_001037188.1.11429 WP_001037188.1.11479 WP_001037188.1.11557 WP_001037188.1.11565 WP_001037188.1.11567 WP_001037188.1.11603 WP_001037188.1.11638 WP_001037188.1.11681 WP_001037188.1.11875 WP_001037188.1.11883 WP_001037188.1.11908 WP_001037188.1.11914 WP_001037188.1.12040 WP_001037188.1.12061 WP_001037188.1.1207 WP_001037188.1.12141 WP_001037188.1.12144 WP_001037188.1.12172 WP_001037188.1.12192 WP_001037188.1.1224 WP_001037188.1.12282 WP_001037188.1.12364 WP_001037188.1.12397 WP_001037188.1.12398 WP_001037188.1.12441 WP_001037188.1.1250 WP_001037188.1.12581 WP_001037188.1.12620 WP_001037188.1.12648 WP_001037188.1.12683 WP_001037188.1.12718 WP_001037188.1.12726 WP_001037188.1.12741 WP_001037188.1.12834 WP_001037188.1.12864 WP_001037188.1.13108 WP_001037188.1.13161 WP_001037188.1.1321 WP_001037188.1.1326 WP_001037188.1.13268 WP_001037188.1.13291 WP_001037188.1.133 WP_001037188.1.13314 WP_001037188.1.13338 WP_001037188.1.13342 WP_001037188.1.13352 WP_001037188.1.13406 WP_001037188.1.13440 WP_001037188.1.13443 WP_001037188.1.13446 WP_001037188.1.13476 WP_001037188.1.13528 WP_001037188.1.13543 WP_001037188.1.13599 WP_001037188.1.1372 WP_001037188.1.13732 WP_001037188.1.13750 WP_001037188.1.1382 WP_001037188.1.13848 WP_001037188.1.1397 WP_001037188.1.13972 WP_001037188.1.1408 WP_001037188.1.14089 WP_001037188.1.14099 WP_001037188.1.14120 WP_001037188.1.14150 WP_001037188.1.14191 WP_001037188.1.14197 WP_001037188.1.14333 WP_001037188.1.14399 WP_001037188.1.14444 WP_001037188.1.14467 WP_001037188.1.14474 WP_001037188.1.14500 WP_001037188.1.14526 WP_001037188.1.14550 WP_001037188.1.14701 WP_001037188.1.14703 WP_001037188.1.14719 WP_001037188.1.14765 WP_001037188.1.14789 WP_001037188.1.14810 WP_001037188.1.14877 WP_001037188.1.14884 WP_001037188.1.14894 WP_001037188.1.14917 WP_001037188.1.14927 WP_001037188.1.14930 WP_001037188.1.14936 WP_001037188.1.14947 WP_001037188.1.14948 WP_001037188.1.15059 WP_001037188.1.15102 WP_001037188.1.15184 WP_001037188.1.15244 WP_001037188.1.15265 WP_001037188.1.15362 WP_001037188.1.15415 WP_001037188.1.15423 WP_001037188.1.15433 WP_001037188.1.15439 WP_001037188.1.15468 WP_001037188.1.15483 WP_001037188.1.15487 WP_001037188.1.15535 WP_001037188.1.15581 WP_001037188.1.15597 WP_001037188.1.15625 WP_001037188.1.15637 WP_001037188.1.15708 WP_001037188.1.15710 WP_001037188.1.15717 WP_001037188.1.15835 WP_001037188.1.15905 WP_001037188.1.15912 WP_001037188.1.15970 WP_001037188.1.15995 WP_001037188.1.16006 WP_001037188.1.16028 WP_001037188.1.16046 WP_001037188.1.16051 WP_001037188.1.16058 WP_001037188.1.16150 WP_001037188.1.16155 WP_001037188.1.16172 WP_001037188.1.1626 WP_001037188.1.16264 WP_001037188.1.16331 WP_001037188.1.16452 WP_001037188.1.16461 WP_001037188.1.16462 WP_001037188.1.16465 WP_001037188.1.16508 WP_001037188.1.16588 WP_001037188.1.16658 WP_001037188.1.16666 WP_001037188.1.16673 WP_001037188.1.1674 WP_001037188.1.16767 WP_001037188.1.16781 WP_001037188.1.16879 WP_001037188.1.1689 WP_001037188.1.16893 WP_001037188.1.16910 WP_001037188.1.16941 WP_001037188.1.16948 WP_001037188.1.16998 WP_001037188.1.17049 WP_001037188.1.17058 WP_001037188.1.17078 WP_001037188.1.17202 WP_001037188.1.17219 WP_001037188.1.1722 WP_001037188.1.17285 WP_001037188.1.17302 WP_001037188.1.17308 WP_001037188.1.17368 WP_001037188.1.1737 WP_001037188.1.17405 WP_001037188.1.17406 WP_001037188.1.17439 WP_001037188.1.17447 WP_001037188.1.17504 WP_001037188.1.17513 WP_001037188.1.17543 WP_001037188.1.17560 WP_001037188.1.17563 WP_001037188.1.17578 WP_001037188.1.17622 WP_001037188.1.17629 WP_001037188.1.17659 WP_001037188.1.17667 WP_001037188.1.17686 WP_001037188.1.17693 WP_001037188.1.17741 WP_001037188.1.17755 WP_001037188.1.17758 WP_001037188.1.17840 WP_001037188.1.17901 WP_001037188.1.17956 WP_001037188.1.17991 WP_001037188.1.18005 WP_001037188.1.1801 WP_001037188.1.18021 WP_001037188.1.18099 WP_001037188.1.18124 WP_001037188.1.1814 WP_001037188.1.18144 WP_001037188.1.18173 WP_001037188.1.18178 WP_001037188.1.18270 WP_001037188.1.18280 WP_001037188.1.18281 WP_001037188.1.18328 WP_001037188.1.18358 WP_001037188.1.18370 WP_001037188.1.18406 WP_001037188.1.18474 WP_001037188.1.18513 WP_001037188.1.18610 WP_001037188.1.18678 WP_001037188.1.18692 WP_001037188.1.18722 WP_001037188.1.18766 WP_001037188.1.1885 WP_001037188.1.18860 WP_001037188.1.18922 WP_001037188.1.18959 WP_001037188.1.1897 WP_001037188.1.19001 WP_001037188.1.19006 WP_001037188.1.19044 WP_001037188.1.19187 WP_001037188.1.19228 WP_001037188.1.19240 WP_001037188.1.19288 WP_001037188.1.19300 WP_001037188.1.19422 WP_001037188.1.19454 WP_001037188.1.19456 WP_001037188.1.19496 WP_001037188.1.19535 WP_001037188.1.19538 WP_001037188.1.19589 WP_001037188.1.19660 WP_001037188.1.19663 WP_001037188.1.19686 WP_001037188.1.19723 WP_001037188.1.19731 WP_001037188.1.19794 WP_001037188.1.19851 WP_001037188.1.1992 WP_001037188.1.19999 WP_001037188.1.20089 WP_001037188.1.20218 WP_001037188.1.20254 WP_001037188.1.20255 WP_001037188.1.20296 WP_001037188.1.20339 WP_001037188.1.2036 WP_001037188.1.20376 WP_001037188.1.20391 WP_001037188.1.20419 WP_001037188.1.20425 WP_001037188.1.20465 WP_001037188.1.20492 WP_001037188.1.20503 WP_001037188.1.2053 WP_001037188.1.20631 WP_001037188.1.20635 WP_001037188.1.20695 WP_001037188.1.2073 WP_001037188.1.20740 WP_001037188.1.20760 WP_001037188.1.20828 WP_001037188.1.2087 WP_001037188.1.20883 WP_001037188.1.20947 WP_001037188.1.20953 WP_001037188.1.2106 WP_001037188.1.21062 WP_001037188.1.21162 WP_001037188.1.21184 WP_001037188.1.21185 WP_001037188.1.21309 WP_001037188.1.21326 WP_001037188.1.21366 WP_001037188.1.21404 WP_001037188.1.21492 WP_001037188.1.21674 WP_001037188.1.21730 WP_001037188.1.21792 WP_001037188.1.21825 WP_001037188.1.21845 WP_001037188.1.21886 WP_001037188.1.21940 WP_001037188.1.21946 WP_001037188.1.21966 WP_001037188.1.22019 WP_001037188.1.22064 WP_001037188.1.22117 WP_001037188.1.22118 WP_001037188.1.22126 WP_001037188.1.2216 WP_001037188.1.22169 WP_001037188.1.22208 WP_001037188.1.22240 WP_001037188.1.2227 WP_001037188.1.22270 WP_001037188.1.22323 WP_001037188.1.22373 WP_001037188.1.22476 WP_001037188.1.22514 WP_001037188.1.22575 WP_001037188.1.22582 WP_001037188.1.22614 WP_001037188.1.22652 WP_001037188.1.2283 WP_001037188.1.2284 WP_001037188.1.22895 WP_001037188.1.22926 WP_001037188.1.22943 WP_001037188.1.22967 WP_001037188.1.23040 WP_001037188.1.23058 WP_001037188.1.23155 WP_001037188.1.23169 WP_001037188.1.23218 WP_001037188.1.23246 WP_001037188.1.23279 WP_001037188.1.2331 WP_001037188.1.2332 WP_001037188.1.23340 WP_001037188.1.2336 WP_001037188.1.23365 WP_001037188.1.23409 WP_001037188.1.23412 WP_001037188.1.2342 WP_001037188.1.23426 WP_001037188.1.23444 WP_001037188.1.23492 WP_001037188.1.23503 WP_001037188.1.23513 WP_001037188.1.23515 WP_001037188.1.23548 WP_001037188.1.23571 WP_001037188.1.23604 WP_001037188.1.23639 WP_001037188.1.23679 WP_001037188.1.23728 WP_001037188.1.23736 WP_001037188.1.2375 WP_001037188.1.23783 WP_001037188.1.23786 WP_001037188.1.23801 WP_001037188.1.24028 WP_001037188.1.24061 WP_001037188.1.24083 WP_001037188.1.24117 WP_001037188.1.24125 WP_001037188.1.24138 WP_001037188.1.2415 WP_001037188.1.24153 WP_001037188.1.24259 WP_001037188.1.24291 WP_001037188.1.24322 WP_001037188.1.24355 WP_001037188.1.24375 WP_001037188.1.24400 WP_001037188.1.24419 WP_001037188.1.24420 WP_001037188.1.24450 WP_001037188.1.24567 WP_001037188.1.24619 WP_001037188.1.24643 WP_001037188.1.2467 WP_001037188.1.24688 WP_001037188.1.24689 WP_001037188.1.24716 WP_001037188.1.2481 WP_001037188.1.24832 WP_001037188.1.24964 WP_001037188.1.25017 WP_001037188.1.25032 WP_001037188.1.25041 WP_001037188.1.25053 WP_001037188.1.25130 WP_001037188.1.25140 WP_001037188.1.25185 WP_001037188.1.25210 WP_001037188.1.25219 WP_001037188.1.2525 WP_001037188.1.25304 WP_001037188.1.25374 WP_001037188.1.25475 WP_001037188.1.25490 WP_001037188.1.25498 WP_001037188.1.25508 WP_001037188.1.25512 WP_001037188.1.2554 WP_001037188.1.25564 WP_001037188.1.25603 WP_001037188.1.2562 WP_001037188.1.25666 WP_001037188.1.25807 WP_001037188.1.25821 WP_001037188.1.25833 WP_001037188.1.25835 WP_001037188.1.25882 WP_001037188.1.25962 WP_001037188.1.25963 WP_001037188.1.26001 WP_001037188.1.26027 WP_001037188.1.26034 WP_001037188.1.26107 WP_001037188.1.26123 WP_001037188.1.2615 WP_001037188.1.26217 WP_001037188.1.26230 WP_001037188.1.26232 WP_001037188.1.26269 WP_001037188.1.26272 WP_001037188.1.26286 WP_001037188.1.26288 WP_001037188.1.26363 WP_001037188.1.26384 WP_001037188.1.26426 WP_001037188.1.26491 WP_001037188.1.2654 WP_001037188.1.26554 WP_001037188.1.26582 WP_001037188.1.26636 WP_001037188.1.2667 WP_001037188.1.26689 WP_001037188.1.2679 WP_001037188.1.26908 WP_001037188.1.2692 WP_001037188.1.26924 WP_001037188.1.26928 WP_001037188.1.26980 WP_001037188.1.270 WP_001037188.1.27008 WP_001037188.1.27027 WP_001037188.1.27051 WP_001037188.1.27055 WP_001037188.1.27070 WP_001037188.1.27077 WP_001037188.1.27086 WP_001037188.1.27087 WP_001037188.1.27111 WP_001037188.1.27115 WP_001037188.1.2713 WP_001037188.1.2717 WP_001037188.1.27228 WP_001037188.1.27255 WP_001037188.1.27282 WP_001037188.1.27285 WP_001037188.1.27309 WP_001037188.1.27329 WP_001037188.1.27361 WP_001037188.1.27419 WP_001037188.1.27452 WP_001037188.1.27523 WP_001037188.1.27565 WP_001037188.1.27595 WP_001037188.1.27598 WP_001037188.1.27679 WP_001037188.1.27706 WP_001037188.1.27755 WP_001037188.1.27775 WP_001037188.1.27785 WP_001037188.1.27798 WP_001037188.1.27900 WP_001037188.1.27928 WP_001037188.1.27945 WP_001037188.1.27969 WP_001037188.1.27997 WP_001037188.1.28004 WP_001037188.1.2809 WP_001037188.1.28116 WP_001037188.1.28155 WP_001037188.1.28198 WP_001037188.1.2822 WP_001037188.1.28229 WP_001037188.1.28235 WP_001037188.1.28301 WP_001037188.1.28384 WP_001037188.1.28386 WP_001037188.1.28395 WP_001037188.1.284 WP_001037188.1.2845 WP_001037188.1.28479 WP_001037188.1.28612 WP_001037188.1.28627 WP_001037188.1.28692 WP_001037188.1.2873 WP_001037188.1.28917 WP_001037188.1.28962 WP_001037188.1.29023 WP_001037188.1.29042 WP_001037188.1.2905 WP_001037188.1.2907 WP_001037188.1.29081 WP_001037188.1.29089 WP_001037188.1.29130 WP_001037188.1.29153 WP_001037188.1.29203 WP_001037188.1.29237 WP_001037188.1.29248 WP_001037188.1.29288 WP_001037188.1.29389 WP_001037188.1.29439 WP_001037188.1.29454 WP_001037188.1.2946 WP_001037188.1.29462 WP_001037188.1.29530 WP_001037188.1.29563 WP_001037188.1.29593 WP_001037188.1.29682 WP_001037188.1.29727 WP_001037188.1.29743 WP_001037188.1.29768 WP_001037188.1.29774 WP_001037188.1.29775 WP_001037188.1.29782 WP_001037188.1.29833 WP_001037188.1.2984 WP_001037188.1.29845 WP_001037188.1.29851 WP_001037188.1.29865 WP_001037188.1.29886 WP_001037188.1.29919 WP_001037188.1.29924 WP_001037188.1.2994 WP_001037188.1.29964 WP_001037188.1.29983 WP_001037188.1.30009 WP_001037188.1.30013 WP_001037188.1.3002 WP_001037188.1.30034 WP_001037188.1.30049 WP_001037188.1.30058 WP_001037188.1.30172 WP_001037188.1.30179 WP_001037188.1.30185 WP_001037188.1.30195 WP_001037188.1.30213 WP_001037188.1.30354 WP_001037188.1.30357 WP_001037188.1.30386 WP_001037188.1.3042 WP_001037188.1.30421 WP_001037188.1.30440 WP_001037188.1.30448 WP_001037188.1.30489 WP_001037188.1.30517 WP_001037188.1.30542 WP_001037188.1.30544 WP_001037188.1.30556 WP_001037188.1.30572 WP_001037188.1.30585 WP_001037188.1.30618 WP_001037188.1.30664 WP_001037188.1.30688 WP_001037188.1.3076 WP_001037188.1.3080 WP_001037188.1.30802 WP_001037188.1.30819 WP_001037188.1.3089 WP_001037188.1.30909 WP_001037188.1.30934 WP_001037188.1.31001 WP_001037188.1.31046 WP_001037188.1.31066 WP_001037188.1.31078 WP_001037188.1.31139 WP_001037188.1.31145 WP_001037188.1.31182 WP_001037188.1.31205 WP_001037188.1.3121 WP_001037188.1.31210 WP_001037188.1.31222 WP_001037188.1.31223 WP_001037188.1.3127 WP_001037188.1.31303 WP_001037188.1.3131 WP_001037188.1.31352 WP_001037188.1.31389 WP_001037188.1.31413 WP_001037188.1.31446 WP_001037188.1.31476 WP_001037188.1.31533 WP_001037188.1.31725 WP_001037188.1.31799 WP_001037188.1.31836 WP_001037188.1.31951 WP_001037188.1.32006 WP_001037188.1.32041 WP_001037188.1.32042 WP_001037188.1.3207 WP_001037188.1.32189 WP_001037188.1.32202 WP_001037188.1.32263 WP_001037188.1.32293 WP_001037188.1.32299 WP_001037188.1.32422 WP_001037188.1.32423 WP_001037188.1.32425 WP_001037188.1.32434 WP_001037188.1.32458 WP_001037188.1.32460 WP_001037188.1.32493 WP_001037188.1.32529 WP_001037188.1.32563 WP_001037188.1.32578 WP_001037188.1.32617 WP_001037188.1.32624 WP_001037188.1.32629 WP_001037188.1.3270 WP_001037188.1.32725 WP_001037188.1.32838 WP_001037188.1.32848 WP_001037188.1.3290 WP_001037188.1.32940 WP_001037188.1.32941 WP_001037188.1.3296 WP_001037188.1.32966 WP_001037188.1.32985 WP_001037188.1.33037 WP_001037188.1.3305 WP_001037188.1.33051 WP_001037188.1.33122 WP_001037188.1.3315 WP_001037188.1.33208 WP_001037188.1.33214 WP_001037188.1.33247 WP_001037188.1.33280 WP_001037188.1.33313 WP_001037188.1.33339 WP_001037188.1.33382 WP_001037188.1.33486 WP_001037188.1.33490 WP_001037188.1.33501 WP_001037188.1.33529 WP_001037188.1.33629 WP_001037188.1.33689 WP_001037188.1.3370 WP_001037188.1.33730 WP_001037188.1.33741 WP_001037188.1.33840 WP_001037188.1.3392 WP_001037188.1.33957 WP_001037188.1.33969 WP_001037188.1.34059 WP_001037188.1.34081 WP_001037188.1.34118 WP_001037188.1.34126 WP_001037188.1.34179 WP_001037188.1.34211 WP_001037188.1.34214 WP_001037188.1.34234 WP_001037188.1.34304 WP_001037188.1.34382 WP_001037188.1.34484 WP_001037188.1.34496 WP_001037188.1.34517 WP_001037188.1.34530 WP_001037188.1.34665 WP_001037188.1.34694 WP_001037188.1.34704 WP_001037188.1.34751 WP_001037188.1.34808 WP_001037188.1.34824 WP_001037188.1.34834 WP_001037188.1.3489 WP_001037188.1.34932 WP_001037188.1.34962 WP_001037188.1.35001 WP_001037188.1.35035 WP_001037188.1.35040 WP_001037188.1.35074 WP_001037188.1.35075 WP_001037188.1.35175 WP_001037188.1.35240 WP_001037188.1.35460 WP_001037188.1.35532 WP_001037188.1.3556 WP_001037188.1.35560 WP_001037188.1.3557 WP_001037188.1.35628 WP_001037188.1.35648 WP_001037188.1.35712 WP_001037188.1.35713 WP_001037188.1.35736 WP_001037188.1.35791 WP_001037188.1.35795 WP_001037188.1.35809 WP_001037188.1.35870 WP_001037188.1.35916 WP_001037188.1.35938 WP_001037188.1.35966 WP_001037188.1.36000 WP_001037188.1.36011 WP_001037188.1.36034 WP_001037188.1.36036 WP_001037188.1.36069 WP_001037188.1.36157 WP_001037188.1.36172 WP_001037188.1.36236 WP_001037188.1.36286 WP_001037188.1.36291 WP_001037188.1.36298 WP_001037188.1.36308 WP_001037188.1.36323 WP_001037188.1.36343 WP_001037188.1.36460 WP_001037188.1.3649 WP_001037188.1.36495 WP_001037188.1.36526 WP_001037188.1.36567 WP_001037188.1.36579 WP_001037188.1.36617 WP_001037188.1.36618 WP_001037188.1.36643 WP_001037188.1.36663 WP_001037188.1.36701 WP_001037188.1.36725 WP_001037188.1.36798 WP_001037188.1.36802 WP_001037188.1.36821 WP_001037188.1.36853 WP_001037188.1.3688 WP_001037188.1.36899 WP_001037188.1.36948 WP_001037188.1.36949 WP_001037188.1.37013 WP_001037188.1.37014 WP_001037188.1.37028 WP_001037188.1.37176 WP_001037188.1.37199 WP_001037188.1.37200 WP_001037188.1.37258 WP_001037188.1.37267 WP_001037188.1.37303 WP_001037188.1.37351 WP_001037188.1.37513 WP_001037188.1.37558 WP_001037188.1.37584 WP_001037188.1.37590 WP_001037188.1.37593 WP_001037188.1.37600 WP_001037188.1.37613 WP_001037188.1.37659 WP_001037188.1.37662 WP_001037188.1.37675 WP_001037188.1.37691 WP_001037188.1.37719 WP_001037188.1.37761 WP_001037188.1.37775 WP_001037188.1.37777 WP_001037188.1.378 WP_001037188.1.379 WP_001037188.1.37941 WP_001037188.1.37985 WP_001037188.1.38061 WP_001037188.1.38064 WP_001037188.1.38108 WP_001037188.1.3816 WP_001037188.1.38199 WP_001037188.1.38207 WP_001037188.1.38261 WP_001037188.1.38266 WP_001037188.1.38273 WP_001037188.1.38310 WP_001037188.1.3834 WP_001037188.1.38351 WP_001037188.1.3838 WP_001037188.1.38381 WP_001037188.1.38408 WP_001037188.1.38440 WP_001037188.1.38486 WP_001037188.1.38515 WP_001037188.1.38595 WP_001037188.1.3860 WP_001037188.1.38642 WP_001037188.1.38734 WP_001037188.1.38797 WP_001037188.1.38877 WP_001037188.1.3891 WP_001037188.1.38942 WP_001037188.1.38983 WP_001037188.1.38996 WP_001037188.1.39038 WP_001037188.1.39056 WP_001037188.1.3907 WP_001037188.1.39105 WP_001037188.1.39113 WP_001037188.1.3914 WP_001037188.1.39140 WP_001037188.1.39147 WP_001037188.1.39161 WP_001037188.1.39210 WP_001037188.1.3931 WP_001037188.1.39435 WP_001037188.1.39471 WP_001037188.1.39497 WP_001037188.1.39502 WP_001037188.1.39530 WP_001037188.1.39553 WP_001037188.1.39620 WP_001037188.1.39632 WP_001037188.1.39659 WP_001037188.1.39667 WP_001037188.1.39775 WP_001037188.1.39879 WP_001037188.1.39890 WP_001037188.1.39941 WP_001037188.1.39945 WP_001037188.1.39947 WP_001037188.1.40095 WP_001037188.1.40097 WP_001037188.1.401 WP_001037188.1.40111 WP_001037188.1.40160 WP_001037188.1.40167 WP_001037188.1.40205 WP_001037188.1.40254 WP_001037188.1.40279 WP_001037188.1.40361 WP_001037188.1.40374 WP_001037188.1.4042 WP_001037188.1.40467 WP_001037188.1.40496 WP_001037188.1.40517 WP_001037188.1.40583 WP_001037188.1.40698 WP_001037188.1.40750 WP_001037188.1.40763 WP_001037188.1.40854 WP_001037188.1.4089 WP_001037188.1.40924 WP_001037188.1.40932 WP_001037188.1.40946 WP_001037188.1.40979 WP_001037188.1.41004 WP_001037188.1.4106 WP_001037188.1.41070 WP_001037188.1.41074 WP_001037188.1.41097 WP_001037188.1.41132 WP_001037188.1.41176 WP_001037188.1.41251 WP_001037188.1.41258 WP_001037188.1.41299 WP_001037188.1.41305 WP_001037188.1.41321 WP_001037188.1.41333 WP_001037188.1.41335 WP_001037188.1.4136 WP_001037188.1.41415 WP_001037188.1.41438 WP_001037188.1.41498 WP_001037188.1.41519 WP_001037188.1.41524 WP_001037188.1.41631 WP_001037188.1.41658 WP_001037188.1.41659 WP_001037188.1.41716 WP_001037188.1.41746 WP_001037188.1.4178 WP_001037188.1.41789 WP_001037188.1.41824 WP_001037188.1.41825 WP_001037188.1.41836 WP_001037188.1.41919 WP_001037188.1.41929 WP_001037188.1.4194 WP_001037188.1.41994 WP_001037188.1.41998 WP_001037188.1.42009 WP_001037188.1.42069 WP_001037188.1.42090 WP_001037188.1.42111 WP_001037188.1.42187 WP_001037188.1.42200 WP_001037188.1.42219 WP_001037188.1.42257 WP_001037188.1.42261 WP_001037188.1.42262 WP_001037188.1.42349 WP_001037188.1.42364 WP_001037188.1.42371 WP_001037188.1.42379 WP_001037188.1.42391 WP_001037188.1.42404 WP_001037188.1.42539 WP_001037188.1.42603 WP_001037188.1.42650 WP_001037188.1.4267 WP_001037188.1.42685 WP_001037188.1.42701 WP_001037188.1.42707 WP_001037188.1.42797 WP_001037188.1.42805 WP_001037188.1.42815 WP_001037188.1.42829 WP_001037188.1.42859 WP_001037188.1.42887 WP_001037188.1.4289 WP_001037188.1.4298 WP_001037188.1.42981 WP_001037188.1.43008 WP_001037188.1.43016 WP_001037188.1.43019 WP_001037188.1.43065 WP_001037188.1.43068 WP_001037188.1.43069 WP_001037188.1.43070 WP_001037188.1.43128 WP_001037188.1.43141 WP_001037188.1.43157 WP_001037188.1.43160 WP_001037188.1.43161 WP_001037188.1.43190 WP_001037188.1.43198 WP_001037188.1.43258 WP_001037188.1.4326 WP_001037188.1.43292 WP_001037188.1.43307 WP_001037188.1.4332 WP_001037188.1.43438 WP_001037188.1.43476 WP_001037188.1.43513 WP_001037188.1.43633 WP_001037188.1.43637 WP_001037188.1.43710 WP_001037188.1.43722 WP_001037188.1.4373 WP_001037188.1.43801 WP_001037188.1.43812 WP_001037188.1.43875 WP_001037188.1.43878 WP_001037188.1.43919 WP_001037188.1.43974 WP_001037188.1.44049 WP_001037188.1.4405 WP_001037188.1.44101 WP_001037188.1.44132 WP_001037188.1.44160 WP_001037188.1.44180 WP_001037188.1.44196 WP_001037188.1.44248 WP_001037188.1.44262 WP_001037188.1.44268 WP_001037188.1.4427 WP_001037188.1.44296 WP_001037188.1.44351 WP_001037188.1.44416 WP_001037188.1.44431 WP_001037188.1.44437 WP_001037188.1.44438 WP_001037188.1.44440 WP_001037188.1.44546 WP_001037188.1.4468 WP_001037188.1.44762 WP_001037188.1.44781 WP_001037188.1.44815 WP_001037188.1.44828 WP_001037188.1.44879 WP_001037188.1.44887 WP_001037188.1.44917 WP_001037188.1.44943 WP_001037188.1.44985 WP_001037188.1.4501 WP_001037188.1.45072 WP_001037188.1.45093 WP_001037188.1.45136 WP_001037188.1.45241 WP_001037188.1.45322 WP_001037188.1.45435 WP_001037188.1.45522 WP_001037188.1.45523 WP_001037188.1.45596 WP_001037188.1.45648 WP_001037188.1.45829 WP_001037188.1.45871 WP_001037188.1.45984 WP_001037188.1.46030 WP_001037188.1.46077 WP_001037188.1.46091 WP_001037188.1.46169 WP_001037188.1.46225 WP_001037188.1.46241 WP_001037188.1.46250 WP_001037188.1.46307 WP_001037188.1.46322 WP_001037188.1.46345 WP_001037188.1.46355 WP_001037188.1.464 WP_001037188.1.46454 WP_001037188.1.46461 WP_001037188.1.46505 WP_001037188.1.46559 WP_001037188.1.46620 WP_001037188.1.46689 WP_001037188.1.46701 WP_001037188.1.46730 WP_001037188.1.46732 WP_001037188.1.46781 WP_001037188.1.46803 WP_001037188.1.46816 WP_001037188.1.46842 WP_001037188.1.4690 WP_001037188.1.46920 WP_001037188.1.46945 WP_001037188.1.46961 WP_001037188.1.47036 WP_001037188.1.47037 WP_001037188.1.47042 WP_001037188.1.47059 WP_001037188.1.47085 WP_001037188.1.47123 WP_001037188.1.47245 WP_001037188.1.47257 WP_001037188.1.47523 WP_001037188.1.47531 WP_001037188.1.47532 WP_001037188.1.47587 WP_001037188.1.47605 WP_001037188.1.47630 WP_001037188.1.47714 WP_001037188.1.4774 WP_001037188.1.47756 WP_001037188.1.4781 WP_001037188.1.47849 WP_001037188.1.47898 WP_001037188.1.47992 WP_001037188.1.48019 WP_001037188.1.48100 WP_001037188.1.48114 WP_001037188.1.48124 WP_001037188.1.48132 WP_001037188.1.48190 WP_001037188.1.48218 WP_001037188.1.48247 WP_001037188.1.48262 WP_001037188.1.48292 WP_001037188.1.48324 WP_001037188.1.48426 WP_001037188.1.48430 WP_001037188.1.48436 WP_001037188.1.48455 WP_001037188.1.48586 WP_001037188.1.4859 WP_001037188.1.48591 WP_001037188.1.48610 WP_001037188.1.48651 WP_001037188.1.48663 WP_001037188.1.48690 WP_001037188.1.48734 WP_001037188.1.48755 WP_001037188.1.48778 WP_001037188.1.48849 WP_001037188.1.48955 WP_001037188.1.48963 WP_001037188.1.48973 WP_001037188.1.49004 WP_001037188.1.49102 WP_001037188.1.49106 WP_001037188.1.49117 WP_001037188.1.49121 WP_001037188.1.4914 WP_001037188.1.49140 WP_001037188.1.49153 WP_001037188.1.49166 WP_001037188.1.49175 WP_001037188.1.49226 WP_001037188.1.49262 WP_001037188.1.49355 WP_001037188.1.49429 WP_001037188.1.49434 WP_001037188.1.49450 WP_001037188.1.49545 WP_001037188.1.49550 WP_001037188.1.49590 WP_001037188.1.49647 WP_001037188.1.49703 WP_001037188.1.49778 WP_001037188.1.49827 WP_001037188.1.49846 WP_001037188.1.4991 WP_001037188.1.49931 WP_001037188.1.49947 WP_001037188.1.49959 WP_001037188.1.49997 WP_001037188.1.50007 WP_001037188.1.50014 WP_001037188.1.50030 WP_001037188.1.50043 WP_001037188.1.5009 WP_001037188.1.50103 WP_001037188.1.50158 WP_001037188.1.50239 WP_001037188.1.50247 WP_001037188.1.50308 WP_001037188.1.50309 WP_001037188.1.50386 WP_001037188.1.50387 WP_001037188.1.50406 WP_001037188.1.50468 WP_001037188.1.50497 WP_001037188.1.5051 WP_001037188.1.50517 WP_001037188.1.50566 WP_001037188.1.50570 WP_001037188.1.50576 WP_001037188.1.50726 WP_001037188.1.50769 WP_001037188.1.50777 WP_001037188.1.50875 WP_001037188.1.50885 WP_001037188.1.50929 WP_001037188.1.50954 WP_001037188.1.50970 WP_001037188.1.51025 WP_001037188.1.51040 WP_001037188.1.51048 WP_001037188.1.51100 WP_001037188.1.51117 WP_001037188.1.51131 WP_001037188.1.51134 WP_001037188.1.51139 WP_001037188.1.51162 WP_001037188.1.51227 WP_001037188.1.5127 WP_001037188.1.51305 WP_001037188.1.51315 WP_001037188.1.51338 WP_001037188.1.5136 WP_001037188.1.51394 WP_001037188.1.51519 WP_001037188.1.51555 WP_001037188.1.51611 WP_001037188.1.51613 WP_001037188.1.51644 WP_001037188.1.51724 WP_001037188.1.51734 WP_001037188.1.51838 WP_001037188.1.51863 WP_001037188.1.51914 WP_001037188.1.51935 WP_001037188.1.52057 WP_001037188.1.52129 WP_001037188.1.52156 WP_001037188.1.5216 WP_001037188.1.52161 WP_001037188.1.52191 WP_001037188.1.52202 WP_001037188.1.52209 WP_001037188.1.52255 WP_001037188.1.52339 WP_001037188.1.52356 WP_001037188.1.52469 WP_001037188.1.52527 WP_001037188.1.52571 WP_001037188.1.526 WP_001037188.1.52647 WP_001037188.1.52675 WP_001037188.1.52742 WP_001037188.1.52773 WP_001037188.1.52795 WP_001037188.1.52807 WP_001037188.1.53016 WP_001037188.1.53092 WP_001037188.1.53141 WP_001037188.1.53151 WP_001037188.1.53154 WP_001037188.1.53158 WP_001037188.1.53159 WP_001037188.1.53210 WP_001037188.1.53233 WP_001037188.1.53307 WP_001037188.1.53328 WP_001037188.1.53368 WP_001037188.1.53375 WP_001037188.1.53450 WP_001037188.1.53454 WP_001037188.1.5349 WP_001037188.1.53540 WP_001037188.1.53555 WP_001037188.1.53559 WP_001037188.1.5356 WP_001037188.1.53571 WP_001037188.1.5358 WP_001037188.1.53692 WP_001037188.1.53694 WP_001037188.1.53696 WP_001037188.1.53723 WP_001037188.1.5374 WP_001037188.1.53750 WP_001037188.1.53772 WP_001037188.1.53800 WP_001037188.1.53815 WP_001037188.1.53839 WP_001037188.1.53892 WP_001037188.1.53898 WP_001037188.1.53902 WP_001037188.1.53958 WP_001037188.1.53981 WP_001037188.1.53984 WP_001037188.1.54061 WP_001037188.1.54082 WP_001037188.1.54132 WP_001037188.1.54170 WP_001037188.1.54175 WP_001037188.1.54259 WP_001037188.1.5430 WP_001037188.1.54333 WP_001037188.1.54371 WP_001037188.1.54431 WP_001037188.1.54442 WP_001037188.1.54482 WP_001037188.1.54589 WP_001037188.1.54667 WP_001037188.1.54678 WP_001037188.1.54681 WP_001037188.1.54694 WP_001037188.1.54748 WP_001037188.1.54774 WP_001037188.1.5481 WP_001037188.1.5485 WP_001037188.1.54865 WP_001037188.1.54935 WP_001037188.1.54979 WP_001037188.1.54984 WP_001037188.1.55010 WP_001037188.1.55034 WP_001037188.1.55163 WP_001037188.1.55165 WP_001037188.1.5517 WP_001037188.1.55215 WP_001037188.1.55223 WP_001037188.1.5527 WP_001037188.1.55290 WP_001037188.1.55294 WP_001037188.1.55310 WP_001037188.1.55317 WP_001037188.1.55379 WP_001037188.1.5539 WP_001037188.1.55461 WP_001037188.1.55468 WP_001037188.1.55506 WP_001037188.1.55604 WP_001037188.1.55639 WP_001037188.1.55680 WP_001037188.1.55699 WP_001037188.1.55706 WP_001037188.1.55725 WP_001037188.1.55780 WP_001037188.1.55967 WP_001037188.1.56144 WP_001037188.1.56172 WP_001037188.1.56222 WP_001037188.1.56226 WP_001037188.1.56247 WP_001037188.1.56305 WP_001037188.1.56311 WP_001037188.1.56389 WP_001037188.1.56393 WP_001037188.1.56419 WP_001037188.1.56423 WP_001037188.1.56514 WP_001037188.1.56535 WP_001037188.1.56585 WP_001037188.1.56640 WP_001037188.1.56651 WP_001037188.1.56825 WP_001037188.1.56887 WP_001037188.1.56889 WP_001037188.1.56981 WP_001037188.1.57101 WP_001037188.1.57125 WP_001037188.1.57137 WP_001037188.1.57147 WP_001037188.1.57149 WP_001037188.1.57179 WP_001037188.1.57186 WP_001037188.1.57342 WP_001037188.1.57357 WP_001037188.1.57510 WP_001037188.1.57555 WP_001037188.1.57699 WP_001037188.1.57735 WP_001037188.1.57778 WP_001037188.1.57781 WP_001037188.1.57797 WP_001037188.1.57800 WP_001037188.1.5781 WP_001037188.1.57902 WP_001037188.1.57965 WP_001037188.1.57972 WP_001037188.1.58008 WP_001037188.1.58044 WP_001037188.1.58081 WP_001037188.1.5809 WP_001037188.1.58132 WP_001037188.1.58173 WP_001037188.1.58191 WP_001037188.1.58194 WP_001037188.1.58249 WP_001037188.1.58252 WP_001037188.1.58261 WP_001037188.1.58274 WP_001037188.1.58301 WP_001037188.1.58324 WP_001037188.1.58326 WP_001037188.1.58357 WP_001037188.1.5836 WP_001037188.1.58485 WP_001037188.1.58537 WP_001037188.1.58564 WP_001037188.1.58568 WP_001037188.1.58583 WP_001037188.1.58604 WP_001037188.1.58633 WP_001037188.1.58652 WP_001037188.1.58663 WP_001037188.1.58724 WP_001037188.1.58729 WP_001037188.1.5875 WP_001037188.1.58807 WP_001037188.1.58831 WP_001037188.1.58861 WP_001037188.1.58883 WP_001037188.1.58898 WP_001037188.1.58949 WP_001037188.1.58963 WP_001037188.1.58970 WP_001037188.1.58974 WP_001037188.1.59020 WP_001037188.1.59043 WP_001037188.1.59056 WP_001037188.1.59061 WP_001037188.1.59064 WP_001037188.1.59125 WP_001037188.1.59136 WP_001037188.1.59236 WP_001037188.1.59295 WP_001037188.1.59313 WP_001037188.1.59439 WP_001037188.1.5949 WP_001037188.1.59501 WP_001037188.1.59510 WP_001037188.1.59604 WP_001037188.1.59648 WP_001037188.1.5969 WP_001037188.1.59751 WP_001037188.1.59827 WP_001037188.1.59847 WP_001037188.1.59863 WP_001037188.1.59928 WP_001037188.1.59969 WP_001037188.1.59994 WP_001037188.1.60045 WP_001037188.1.60076 WP_001037188.1.60114 WP_001037188.1.60154 WP_001037188.1.60168 WP_001037188.1.60192 WP_001037188.1.60199 WP_001037188.1.60212 WP_001037188.1.60231 WP_001037188.1.60253 WP_001037188.1.60322 WP_001037188.1.60324 WP_001037188.1.60356 WP_001037188.1.6038 WP_001037188.1.60380 WP_001037188.1.6041 WP_001037188.1.60424 WP_001037188.1.605 WP_001037188.1.6052 WP_001037188.1.6058 WP_001037188.1.60584 WP_001037188.1.60597 WP_001037188.1.6060 WP_001037188.1.60643 WP_001037188.1.60661 WP_001037188.1.60676 WP_001037188.1.60708 WP_001037188.1.60725 WP_001037188.1.60746 WP_001037188.1.60783 WP_001037188.1.60792 WP_001037188.1.60807 WP_001037188.1.60838 WP_001037188.1.60851 WP_001037188.1.60855 WP_001037188.1.60882 WP_001037188.1.60889 WP_001037188.1.6090 WP_001037188.1.60926 WP_001037188.1.60950 WP_001037188.1.6104 WP_001037188.1.61044 WP_001037188.1.61076 WP_001037188.1.61123 WP_001037188.1.61146 WP_001037188.1.61147 WP_001037188.1.61201 WP_001037188.1.61210 WP_001037188.1.61218 WP_001037188.1.61233 WP_001037188.1.61357 WP_001037188.1.61511 WP_001037188.1.61539 WP_001037188.1.61542 WP_001037188.1.61553 WP_001037188.1.61649 WP_001037188.1.61652 WP_001037188.1.61662 WP_001037188.1.61667 WP_001037188.1.61697 WP_001037188.1.61783 WP_001037188.1.61809 WP_001037188.1.61877 WP_001037188.1.61920 WP_001037188.1.6210 WP_001037188.1.62124 WP_001037188.1.62184 WP_001037188.1.62199 WP_001037188.1.62223 WP_001037188.1.62302 WP_001037188.1.62314 WP_001037188.1.62323 WP_001037188.1.62333 WP_001037188.1.62338 WP_001037188.1.62380 WP_001037188.1.62411 WP_001037188.1.62436 WP_001037188.1.62475 WP_001037188.1.62536 WP_001037188.1.62564 WP_001037188.1.62619 WP_001037188.1.62640 WP_001037188.1.62686 WP_001037188.1.62751 WP_001037188.1.62825 WP_001037188.1.62932 WP_001037188.1.62960 WP_001037188.1.63016 WP_001037188.1.63025 WP_001037188.1.63043 WP_001037188.1.63069 WP_001037188.1.63087 WP_001037188.1.63169 WP_001037188.1.63234 WP_001037188.1.63243 WP_001037188.1.63297 WP_001037188.1.63448 WP_001037188.1.63514 WP_001037188.1.63583 WP_001037188.1.63592 WP_001037188.1.63663 WP_001037188.1.63677 WP_001037188.1.63736 WP_001037188.1.63816 WP_001037188.1.63824 WP_001037188.1.63876 WP_001037188.1.6389 WP_001037188.1.63901 WP_001037188.1.63955 WP_001037188.1.63963 WP_001037188.1.63992 WP_001037188.1.64032 WP_001037188.1.64087 WP_001037188.1.6415 WP_001037188.1.64208 WP_001037188.1.64242 WP_001037188.1.64332 WP_001037188.1.64376 WP_001037188.1.64389 WP_001037188.1.644 WP_001037188.1.64501 WP_001037188.1.64538 WP_001037188.1.64569 WP_001037188.1.64632 WP_001037188.1.64645 WP_001037188.1.64648 WP_001037188.1.64654 WP_001037188.1.64662 WP_001037188.1.64663 WP_001037188.1.64667 WP_001037188.1.64709 WP_001037188.1.64710 WP_001037188.1.64744 WP_001037188.1.64763 WP_001037188.1.64817 WP_001037188.1.64847 WP_001037188.1.6487 WP_001037188.1.64891 WP_001037188.1.64920 WP_001037188.1.64974 WP_001037188.1.64977 WP_001037188.1.65022 WP_001037188.1.65054 WP_001037188.1.65075 WP_001037188.1.6514 WP_001037188.1.65163 WP_001037188.1.65168 WP_001037188.1.65172 WP_001037188.1.65191 WP_001037188.1.65200 WP_001037188.1.65211 WP_001037188.1.65218 WP_001037188.1.65226 WP_001037188.1.65238 WP_001037188.1.65266 WP_001037188.1.65363 WP_001037188.1.65394 WP_001037188.1.65395 WP_001037188.1.65459 WP_001037188.1.65463 WP_001037188.1.65487 WP_001037188.1.6549 WP_001037188.1.65499 WP_001037188.1.65538 WP_001037188.1.6554 WP_001037188.1.65558 WP_001037188.1.6560 WP_001037188.1.65650 WP_001037188.1.65687 WP_001037188.1.65697 WP_001037188.1.65699 WP_001037188.1.65737 WP_001037188.1.65755 WP_001037188.1.65790 WP_001037188.1.65812 WP_001037188.1.65838 WP_001037188.1.65846 WP_001037188.1.65863 WP_001037188.1.65968 WP_001037188.1.65985 WP_001037188.1.66021 WP_001037188.1.66031 WP_001037188.1.66052 WP_001037188.1.66064 WP_001037188.1.66109 WP_001037188.1.66129 WP_001037188.1.66145 WP_001037188.1.66167 WP_001037188.1.66183 WP_001037188.1.6620 WP_001037188.1.66216 WP_001037188.1.66234 WP_001037188.1.66250 WP_001037188.1.66270 WP_001037188.1.66273 WP_001037188.1.66324 WP_001037188.1.6634 WP_001037188.1.66361 WP_001037188.1.66365 WP_001037188.1.66462 WP_001037188.1.66480 WP_001037188.1.66506 WP_001037188.1.66534 WP_001037188.1.66630 WP_001037188.1.66665 WP_001037188.1.66681 WP_001037188.1.66684 WP_001037188.1.66702 WP_001037188.1.66755 WP_001037188.1.66759 WP_001037188.1.66801 WP_001037188.1.66824 WP_001037188.1.66860 WP_001037188.1.66876 WP_001037188.1.66953 WP_001037188.1.66955 WP_001037188.1.66981 WP_001037188.1.67024 WP_001037188.1.67042 WP_001037188.1.67101 WP_001037188.1.67143 WP_001037188.1.67184 WP_001037188.1.67201 WP_001037188.1.67237 WP_001037188.1.67336 WP_001037188.1.67339 WP_001037188.1.67374 WP_001037188.1.67387 WP_001037188.1.67394 WP_001037188.1.67397 WP_001037188.1.67403 WP_001037188.1.67424 WP_001037188.1.67430 WP_001037188.1.67442 WP_001037188.1.67539 WP_001037188.1.67556 WP_001037188.1.67576 WP_001037188.1.67604 WP_001037188.1.67625 WP_001037188.1.67627 WP_001037188.1.67641 WP_001037188.1.67657 WP_001037188.1.67673 WP_001037188.1.67700 WP_001037188.1.67718 WP_001037188.1.67729 WP_001037188.1.67774 WP_001037188.1.67820 WP_001037188.1.67905 WP_001037188.1.67910 WP_001037188.1.67954 WP_001037188.1.67977 WP_001037188.1.68 WP_001037188.1.68043 WP_001037188.1.68105 WP_001037188.1.68113 WP_001037188.1.68115 WP_001037188.1.68131 WP_001037188.1.68182 WP_001037188.1.6819 WP_001037188.1.68210 WP_001037188.1.68285 WP_001037188.1.6833 WP_001037188.1.68359 WP_001037188.1.68420 WP_001037188.1.68478 WP_001037188.1.68514 WP_001037188.1.68564 WP_001037188.1.6858 WP_001037188.1.68688 WP_001037188.1.6869 WP_001037188.1.68742 WP_001037188.1.6875 WP_001037188.1.68809 WP_001037188.1.68818 WP_001037188.1.6883 WP_001037188.1.68914 WP_001037188.1.69011 WP_001037188.1.6905 WP_001037188.1.69053 WP_001037188.1.69170 WP_001037188.1.69210 WP_001037188.1.69270 WP_001037188.1.69282 WP_001037188.1.69288 WP_001037188.1.69320 WP_001037188.1.69371 WP_001037188.1.69376 WP_001037188.1.69396 WP_001037188.1.69465 WP_001037188.1.69466 WP_001037188.1.69515 WP_001037188.1.69592 WP_001037188.1.69597 WP_001037188.1.69611 WP_001037188.1.69642 WP_001037188.1.69656 WP_001037188.1.69657 WP_001037188.1.69690 WP_001037188.1.69807 WP_001037188.1.69923 WP_001037188.1.69948 WP_001037188.1.69953 WP_001037188.1.69982 WP_001037188.1.70010 WP_001037188.1.70049 WP_001037188.1.70058 WP_001037188.1.70061 WP_001037188.1.7014 WP_001037188.1.7016 WP_001037188.1.70205 WP_001037188.1.70240 WP_001037188.1.70249 WP_001037188.1.70261 WP_001037188.1.70290 WP_001037188.1.70314 WP_001037188.1.70326 WP_001037188.1.7033 WP_001037188.1.70427 WP_001037188.1.70433 WP_001037188.1.70488 WP_001037188.1.70523 WP_001037188.1.70545 WP_001037188.1.70547 WP_001037188.1.70580 WP_001037188.1.70623 WP_001037188.1.70671 WP_001037188.1.70731 WP_001037188.1.70732 WP_001037188.1.70772 WP_001037188.1.70845 WP_001037188.1.70846 WP_001037188.1.70969 WP_001037188.1.70981 WP_001037188.1.70995 WP_001037188.1.71039 WP_001037188.1.71057 WP_001037188.1.71081 WP_001037188.1.71117 WP_001037188.1.71150 WP_001037188.1.71171 WP_001037188.1.71186 WP_001037188.1.71407 WP_001037188.1.71418 WP_001037188.1.71456 WP_001037188.1.71487 WP_001037188.1.71500 WP_001037188.1.71523 WP_001037188.1.71542 WP_001037188.1.71566 WP_001037188.1.71640 WP_001037188.1.71651 WP_001037188.1.71653 WP_001037188.1.71716 WP_001037188.1.71872 WP_001037188.1.71929 WP_001037188.1.71950 WP_001037188.1.71954 WP_001037188.1.72003 WP_001037188.1.72065 WP_001037188.1.72068 WP_001037188.1.72073 WP_001037188.1.72188 WP_001037188.1.72269 WP_001037188.1.72307 WP_001037188.1.72383 WP_001037188.1.72412 WP_001037188.1.72461 WP_001037188.1.72527 WP_001037188.1.7255 WP_001037188.1.72631 WP_001037188.1.72638 WP_001037188.1.72667 WP_001037188.1.72674 WP_001037188.1.72724 WP_001037188.1.72789 WP_001037188.1.72828 WP_001037188.1.72850 WP_001037188.1.72887 WP_001037188.1.72896 WP_001037188.1.72969 WP_001037188.1.72987 WP_001037188.1.73052 WP_001037188.1.7311 WP_001037188.1.73114 WP_001037188.1.73144 WP_001037188.1.73164 WP_001037188.1.73177 WP_001037188.1.73180 WP_001037188.1.73258 WP_001037188.1.73270 WP_001037188.1.73285 WP_001037188.1.7332 WP_001037188.1.7333 WP_001037188.1.73352 WP_001037188.1.73362 WP_001037188.1.73379 WP_001037188.1.73389 WP_001037188.1.73425 WP_001037188.1.73488 WP_001037188.1.73504 WP_001037188.1.7353 WP_001037188.1.73535 WP_001037188.1.73544 WP_001037188.1.73598 WP_001037188.1.7361 WP_001037188.1.73648 WP_001037188.1.73768 WP_001037188.1.73849 WP_001037188.1.7394 WP_001037188.1.73948 WP_001037188.1.73965 WP_001037188.1.73999 WP_001037188.1.74024 WP_001037188.1.74030 WP_001037188.1.74038 WP_001037188.1.74043 WP_001037188.1.74058 WP_001037188.1.74070 WP_001037188.1.74077 WP_001037188.1.74135 WP_001037188.1.74214 WP_001037188.1.74241 WP_001037188.1.74285 WP_001037188.1.7430 WP_001037188.1.74415 WP_001037188.1.74422 WP_001037188.1.74500 WP_001037188.1.74570 WP_001037188.1.74616 WP_001037188.1.74621 WP_001037188.1.74644 WP_001037188.1.74647 WP_001037188.1.74677 WP_001037188.1.74699 WP_001037188.1.74702 WP_001037188.1.74894 WP_001037188.1.74929 WP_001037188.1.74973 WP_001037188.1.74996 WP_001037188.1.7507 WP_001037188.1.75116 WP_001037188.1.75237 WP_001037188.1.75273 WP_001037188.1.75296 WP_001037188.1.75413 WP_001037188.1.75433 WP_001037188.1.75532 WP_001037188.1.75565 WP_001037188.1.75593 WP_001037188.1.75610 WP_001037188.1.75633 WP_001037188.1.75664 WP_001037188.1.75703 WP_001037188.1.75718 WP_001037188.1.75745 WP_001037188.1.75793 WP_001037188.1.75844 WP_001037188.1.75873 WP_001037188.1.75886 WP_001037188.1.75898 WP_001037188.1.75957 WP_001037188.1.76081 WP_001037188.1.76116 WP_001037188.1.76122 WP_001037188.1.76162 WP_001037188.1.76186 WP_001037188.1.76208 WP_001037188.1.7629 WP_001037188.1.76339 WP_001037188.1.76366 WP_001037188.1.76417 WP_001037188.1.7646 WP_001037188.1.76510 WP_001037188.1.76529 WP_001037188.1.76558 WP_001037188.1.7657 WP_001037188.1.76572 WP_001037188.1.76641 WP_001037188.1.76651 WP_001037188.1.76653 WP_001037188.1.76724 WP_001037188.1.76738 WP_001037188.1.76788 WP_001037188.1.76854 WP_001037188.1.76916 WP_001037188.1.76932 WP_001037188.1.76973 WP_001037188.1.76988 WP_001037188.1.77016 WP_001037188.1.77087 WP_001037188.1.77090 WP_001037188.1.77111 WP_001037188.1.77193 WP_001037188.1.77299 WP_001037188.1.77414 WP_001037188.1.77501 WP_001037188.1.77512 WP_001037188.1.77513 WP_001037188.1.77543 WP_001037188.1.77563 WP_001037188.1.77575 WP_001037188.1.77653 WP_001037188.1.77702 WP_001037188.1.77713 WP_001037188.1.7772 WP_001037188.1.77729 WP_001037188.1.77761 WP_001037188.1.77825 WP_001037188.1.77846 WP_001037188.1.77900 WP_001037188.1.77923 WP_001037188.1.77975 WP_001037188.1.78035 WP_001037188.1.78048 WP_001037188.1.78107 WP_001037188.1.78166 WP_001037188.1.78168 WP_001037188.1.78192 WP_001037188.1.78195 WP_001037188.1.78291 WP_001037188.1.78309 WP_001037188.1.78320 WP_001037188.1.78382 WP_001037188.1.78388 WP_001037188.1.78410 WP_001037188.1.78495 WP_001037188.1.78496 WP_001037188.1.78602 WP_001037188.1.7862 WP_001037188.1.78661 WP_001037188.1.78674 WP_001037188.1.78676 WP_001037188.1.78761 WP_001037188.1.78862 WP_001037188.1.789 WP_001037188.1.7891 WP_001037188.1.78993 WP_001037188.1.79012 WP_001037188.1.79069 WP_001037188.1.79074 WP_001037188.1.79098 WP_001037188.1.79189 WP_001037188.1.79204 WP_001037188.1.79235 WP_001037188.1.79280 WP_001037188.1.79297 WP_001037188.1.79397 WP_001037188.1.79456 WP_001037188.1.79532 WP_001037188.1.79547 WP_001037188.1.79654 WP_001037188.1.7970 WP_001037188.1.79722 WP_001037188.1.79772 WP_001037188.1.79832 WP_001037188.1.79880 WP_001037188.1.79892 WP_001037188.1.79929 WP_001037188.1.80065 WP_001037188.1.80229 WP_001037188.1.80250 WP_001037188.1.80273 WP_001037188.1.80282 WP_001037188.1.80293 WP_001037188.1.80354 WP_001037188.1.80368 WP_001037188.1.80386 WP_001037188.1.80400 WP_001037188.1.80448 WP_001037188.1.80462 WP_001037188.1.8049 WP_001037188.1.80492 WP_001037188.1.80569 WP_001037188.1.80629 WP_001037188.1.80664 WP_001037188.1.80696 WP_001037188.1.80827 WP_001037188.1.80857 WP_001037188.1.80984 WP_001037188.1.81131 WP_001037188.1.81187 WP_001037188.1.81262 WP_001037188.1.81268 WP_001037188.1.81269 WP_001037188.1.8127 WP_001037188.1.81275 WP_001037188.1.81302 WP_001037188.1.8131 WP_001037188.1.81333 WP_001037188.1.81342 WP_001037188.1.81364 WP_001037188.1.81472 WP_001037188.1.81494 WP_001037188.1.81557 WP_001037188.1.81667 WP_001037188.1.81676 WP_001037188.1.81681 WP_001037188.1.8170 WP_001037188.1.81763 WP_001037188.1.81855 WP_001037188.1.81921 WP_001037188.1.81931 WP_001037188.1.81949 WP_001037188.1.81965 WP_001037188.1.82070 WP_001037188.1.82076 WP_001037188.1.82099 WP_001037188.1.82131 WP_001037188.1.82141 WP_001037188.1.82156 WP_001037188.1.82180 WP_001037188.1.82201 WP_001037188.1.82214 WP_001037188.1.82225 WP_001037188.1.82347 WP_001037188.1.82352 WP_001037188.1.8240 WP_001037188.1.82408 WP_001037188.1.82416 WP_001037188.1.8242 WP_001037188.1.82456 WP_001037188.1.82465 WP_001037188.1.82473 WP_001037188.1.82529 WP_001037188.1.82530 WP_001037188.1.82553 WP_001037188.1.82570 WP_001037188.1.82637 WP_001037188.1.82648 WP_001037188.1.82670 WP_001037188.1.82731 WP_001037188.1.82812 WP_001037188.1.82843 WP_001037188.1.82850 WP_001037188.1.82872 WP_001037188.1.82895 WP_001037188.1.82899 WP_001037188.1.8294 WP_001037188.1.82959 WP_001037188.1.82992 WP_001037188.1.83007 WP_001037188.1.8304 WP_001037188.1.83061 WP_001037188.1.83180 WP_001037188.1.83229 WP_001037188.1.83235 WP_001037188.1.83247 WP_001037188.1.83290 WP_001037188.1.83301 WP_001037188.1.83333 WP_001037188.1.83360 WP_001037188.1.83382 WP_001037188.1.83388 WP_001037188.1.83657 WP_001037188.1.83677 WP_001037188.1.8375 WP_001037188.1.83759 WP_001037188.1.83923 WP_001037188.1.83994 WP_001037188.1.84 WP_001037188.1.8406 WP_001037188.1.84076 WP_001037188.1.84077 WP_001037188.1.84106 WP_001037188.1.84110 WP_001037188.1.84127 WP_001037188.1.84150 WP_001037188.1.84229 WP_001037188.1.84230 WP_001037188.1.84252 WP_001037188.1.8431 WP_001037188.1.84345 WP_001037188.1.84369 WP_001037188.1.84401 WP_001037188.1.84435 WP_001037188.1.84567 WP_001037188.1.84631 WP_001037188.1.84721 WP_001037188.1.84727 WP_001037188.1.84744 WP_001037188.1.84773 WP_001037188.1.84945 WP_001037188.1.84967 WP_001037188.1.850 WP_001037188.1.85004 WP_001037188.1.85014 WP_001037188.1.8502 WP_001037188.1.85031 WP_001037188.1.85039 WP_001037188.1.85120 WP_001037188.1.85147 WP_001037188.1.85153 WP_001037188.1.85273 WP_001037188.1.85338 WP_001037188.1.85339 WP_001037188.1.85469 WP_001037188.1.85511 WP_001037188.1.85512 WP_001037188.1.8552 WP_001037188.1.8557 WP_001037188.1.85606 WP_001037188.1.85635 WP_001037188.1.85646 WP_001037188.1.85669 WP_001037188.1.85688 WP_001037188.1.85703 WP_001037188.1.85723 WP_001037188.1.85728 WP_001037188.1.85746 WP_001037188.1.85811 WP_001037188.1.85854 WP_001037188.1.859 WP_001037188.1.8591 WP_001037188.1.85917 WP_001037188.1.8594 WP_001037188.1.85977 WP_001037188.1.860 WP_001037188.1.86010 WP_001037188.1.86017 WP_001037188.1.8605 WP_001037188.1.86084 WP_001037188.1.8610 WP_001037188.1.8614 WP_001037188.1.86156 WP_001037188.1.86206 WP_001037188.1.86285 WP_001037188.1.86310 WP_001037188.1.86323 WP_001037188.1.86342 WP_001037188.1.8640 WP_001037188.1.8642 WP_001037188.1.86426 WP_001037188.1.86489 WP_001037188.1.86530 WP_001037188.1.86634 WP_001037188.1.86770 WP_001037188.1.86794 WP_001037188.1.86800 WP_001037188.1.86811 WP_001037188.1.86815 WP_001037188.1.86921 WP_001037188.1.86945 WP_001037188.1.86982 WP_001037188.1.86989 WP_001037188.1.87023 WP_001037188.1.87034 WP_001037188.1.87041 WP_001037188.1.87051 WP_001037188.1.87143 WP_001037188.1.87155 WP_001037188.1.87219 WP_001037188.1.87258 WP_001037188.1.87283 WP_001037188.1.87293 WP_001037188.1.87346 WP_001037188.1.87370 WP_001037188.1.87420 WP_001037188.1.87528 WP_001037188.1.87560 WP_001037188.1.8760 WP_001037188.1.87600 WP_001037188.1.87609 WP_001037188.1.87612 WP_001037188.1.87615 WP_001037188.1.87618 WP_001037188.1.87626 WP_001037188.1.87653 WP_001037188.1.87659 WP_001037188.1.87698 WP_001037188.1.87706 WP_001037188.1.87739 WP_001037188.1.87741 WP_001037188.1.87742 WP_001037188.1.87852 WP_001037188.1.87949 WP_001037188.1.87999 WP_001037188.1.88014 WP_001037188.1.88025 WP_001037188.1.88026 WP_001037188.1.8805 WP_001037188.1.8806 WP_001037188.1.881 WP_001037188.1.88145 WP_001037188.1.88199 WP_001037188.1.88299 WP_001037188.1.88313 WP_001037188.1.88359 WP_001037188.1.88407 WP_001037188.1.88414 WP_001037188.1.88446 WP_001037188.1.88458 WP_001037188.1.88501 WP_001037188.1.88538 WP_001037188.1.88547 WP_001037188.1.886 WP_001037188.1.88647 WP_001037188.1.88648 WP_001037188.1.88675 WP_001037188.1.88692 WP_001037188.1.88727 WP_001037188.1.88762 WP_001037188.1.88772 WP_001037188.1.88850 WP_001037188.1.8889 WP_001037188.1.88894 WP_001037188.1.88942 WP_001037188.1.88967 WP_001037188.1.89182 WP_001037188.1.89298 WP_001037188.1.89308 WP_001037188.1.89314 WP_001037188.1.89328 WP_001037188.1.89332 WP_001037188.1.89343 WP_001037188.1.89395 WP_001037188.1.8940 WP_001037188.1.89449 WP_001037188.1.8947 WP_001037188.1.89503 WP_001037188.1.89591 WP_001037188.1.89612 WP_001037188.1.89668 WP_001037188.1.89706 WP_001037188.1.89713 WP_001037188.1.89733 WP_001037188.1.89796 WP_001037188.1.89804 WP_001037188.1.89845 WP_001037188.1.89888 WP_001037188.1.89914 WP_001037188.1.89940 WP_001037188.1.8995 WP_001037188.1.89952 WP_001037188.1.90007 WP_001037188.1.9002 WP_001037188.1.90084 WP_001037188.1.9011 WP_001037188.1.90193 WP_001037188.1.90196 WP_001037188.1.90240 WP_001037188.1.90248 WP_001037188.1.90274 WP_001037188.1.90280 WP_001037188.1.90338 WP_001037188.1.90363 WP_001037188.1.90365 WP_001037188.1.90428 WP_001037188.1.90440 WP_001037188.1.90489 WP_001037188.1.90513 WP_001037188.1.90582 WP_001037188.1.9064 WP_001037188.1.90713 WP_001037188.1.90794 WP_001037188.1.90796 WP_001037188.1.90811 WP_001037188.1.90866 WP_001037188.1.90878 WP_001037188.1.9091 WP_001037188.1.91023 WP_001037188.1.91049 WP_001037188.1.91067 WP_001037188.1.91164 WP_001037188.1.91205 WP_001037188.1.91239 WP_001037188.1.91291 WP_001037188.1.91313 WP_001037188.1.91473 WP_001037188.1.91506 WP_001037188.1.91557 WP_001037188.1.91579 WP_001037188.1.91597 WP_001037188.1.91702 WP_001037188.1.91715 WP_001037188.1.9187 WP_001037188.1.91870 WP_001037188.1.92018 WP_001037188.1.92047 WP_001037188.1.92067 WP_001037188.1.92087 WP_001037188.1.92098 WP_001037188.1.92149 WP_001037188.1.92172 WP_001037188.1.92240 WP_001037188.1.92243 WP_001037188.1.92299 WP_001037188.1.92327 WP_001037188.1.92375 WP_001037188.1.92399 WP_001037188.1.92439 WP_001037188.1.92470 WP_001037188.1.92477 WP_001037188.1.92529 WP_001037188.1.92545 WP_001037188.1.92570 WP_001037188.1.92588 WP_001037188.1.926 WP_001037188.1.92633 WP_001037188.1.92649 WP_001037188.1.92659 WP_001037188.1.92676 WP_001037188.1.92705 WP_001037188.1.9271 WP_001037188.1.92734 WP_001037188.1.92810 WP_001037188.1.92823 WP_001037188.1.92883 WP_001037188.1.92926 WP_001037188.1.92939 WP_001037188.1.92987 WP_001037188.1.92988 WP_001037188.1.93007 WP_001037188.1.93022 WP_001037188.1.93103 WP_001037188.1.93105 WP_001037188.1.93111 WP_001037188.1.93168 WP_001037188.1.93184 WP_001037188.1.93213 WP_001037188.1.93221 WP_001037188.1.93223 WP_001037188.1.93302 WP_001037188.1.9336 WP_001037188.1.93387 WP_001037188.1.93469 WP_001037188.1.93511 WP_001037188.1.93512 WP_001037188.1.93596 WP_001037188.1.93657 WP_001037188.1.93741 WP_001037188.1.9375 WP_001037188.1.93754 WP_001037188.1.93761 WP_001037188.1.93767 WP_001037188.1.93780 WP_001037188.1.93842 WP_001037188.1.93843 WP_001037188.1.93875 WP_001037188.1.93909 WP_001037188.1.93919 WP_001037188.1.93938 WP_001037188.1.93956 WP_001037188.1.93984 WP_001037188.1.93986 WP_001037188.1.9399 WP_001037188.1.94017 WP_001037188.1.94064 WP_001037188.1.94079 WP_001037188.1.94097 WP_001037188.1.94107 WP_001037188.1.94142 WP_001037188.1.94181 WP_001037188.1.94215 WP_001037188.1.94303 WP_001037188.1.94365 WP_001037188.1.94390 WP_001037188.1.94415 WP_001037188.1.94492 WP_001037188.1.94510 WP_001037188.1.94573 WP_001037188.1.94579 WP_001037188.1.94586 WP_001037188.1.94593 WP_001037188.1.94650 WP_001037188.1.94659 WP_001037188.1.94662 WP_001037188.1.94669 WP_001037188.1.94700 WP_001037188.1.94745 WP_001037188.1.94782 WP_001037188.1.94785 WP_001037188.1.94815 WP_001037188.1.94820 WP_001037188.1.94850 WP_001037188.1.94851 WP_001037188.1.94864 WP_001037188.1.94947 WP_001037188.1.94952 WP_001037188.1.94971 WP_001037188.1.95006 WP_001037188.1.95055 WP_001037188.1.95076 WP_001037188.1.95099 WP_001037188.1.9516 WP_001037188.1.95165 WP_001037188.1.95171 WP_001037188.1.95239 WP_001037188.1.95246 WP_001037188.1.95249 WP_001037188.1.9525 WP_001037188.1.95255 WP_001037188.1.95265 WP_001037188.1.95298 WP_001037188.1.95338 WP_001037188.1.95412 WP_001037188.1.95530 WP_001037188.1.95547 WP_001037188.1.95579 WP_001037188.1.95590 WP_001037188.1.95625 WP_001037188.1.95716 WP_001037188.1.9574 WP_001037188.1.95884 WP_001037188.1.95890 WP_001037188.1.95906 WP_001037188.1.96025 WP_001037188.1.96044 WP_001037188.1.96045 WP_001037188.1.96054 WP_001037188.1.96127 WP_001037188.1.96144 WP_001037188.1.96188 WP_001037188.1.96211 WP_001037188.1.96212 WP_001037188.1.96319 WP_001037188.1.9633 WP_001037188.1.96359 WP_001037188.1.96533 WP_001037188.1.96539 WP_001037188.1.96552 WP_001037188.1.96590 WP_001037188.1.96600 WP_001037188.1.96610 WP_001037188.1.96625 WP_001037188.1.96635 WP_001037188.1.9664 WP_001037188.1.96662 WP_001037188.1.96675 WP_001037188.1.9670 WP_001037188.1.96721 WP_001037188.1.96750 WP_001037188.1.96792 WP_001037188.1.96798 WP_001037188.1.96801 WP_001037188.1.96803 WP_001037188.1.96810 WP_001037188.1.96917 WP_001037188.1.96938 WP_001037188.1.96946 WP_001037188.1.96957 WP_001037188.1.96978 WP_001037188.1.97026 WP_001037188.1.97028 WP_001037188.1.97079 WP_001037188.1.97154 WP_001037188.1.97184 WP_001037188.1.97224 WP_001037188.1.97260 WP_001037188.1.97287 WP_001037188.1.97369 WP_001037188.1.97441 WP_001037188.1.97497 WP_001037188.1.97505 WP_001037188.1.97599 WP_001037188.1.97606 WP_001037188.1.97615 WP_001037188.1.97646 WP_001037188.1.97690 WP_001037188.1.97691 WP_001037188.1.97725 WP_001037188.1.97819 WP_001037188.1.97840 WP_001037188.1.97938 WP_001037188.1.97986 WP_001037188.1.98036 WP_001037188.1.98080 WP_001037188.1.98086 WP_001037188.1.9811 WP_001037188.1.98158 WP_001037188.1.98263 WP_001037188.1.98314 WP_001037188.1.98392 WP_001037188.1.98418 WP_001037188.1.98448 WP_001037188.1.98457 WP_001037188.1.9850 WP_001037188.1.98502 WP_001037188.1.98513 WP_001037188.1.98607 WP_001037188.1.98627 WP_001037188.1.98731 WP_001037188.1.98762 WP_001037188.1.98763 WP_001037188.1.9877 WP_001037188.1.98779 WP_001037188.1.98801 WP_001037188.1.98818 WP_001037188.1.99163 WP_001037188.1.99335 WP_001037188.1.99350 WP_001037188.1.99360 WP_001037188.1.99363 WP_001037188.1.99369 WP_001037188.1.99397 WP_001037188.1.99426 WP_001037188.1.99463 WP_001037188.1.99483 WP_001037188.1.99546 WP_001037188.1.99579 WP_001037188.1.99595 WP_001037188.1.99637 WP_001037188.1.99671 WP_001037188.1.99676 WP_001037188.1.99725 WP_001037188.1.99764 WP_001037188.1.99829 WP_001037188.1.99837 WP_001037188.1.9992 WP_001037188.1.99996 gi|378959258|ref|YP_005216744.1| gi|16760674|ref|NP_456291.1| gi|488653630|ref|YP_007925433.1| ABFG01000001|CDS_453876-452191 ABFH02000002|CDS_214972-213287 AE014613|CDS_1180697-1179012 AE017220|CDS_1891813-1893498 AL513382|CDS_1800435-1802120 CP000857|CDS_2000173-1998488 CP001113|CDS_1875012-1876697 209261.t1095 220341.STY1907 321314.SC1775 423368.SNSL254_A1914 476213.SPC_1951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]