SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321327.CYA_1963 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321327.CYA_1963
Domain Number 1 Region: 108-348
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.07e-53
Family D-glucarate dehydratase-like 0.00021
Further Details:      
 
Domain Number 2 Region: 3-120
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.3e-26
Family Enolase N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 321327.CYA_1963
Sequence length 349
Comment (Cyanobacteria bacterium Yellowstone A-Prime)
Sequence
MRLYVEPFTVHKRYALTISRGTHSDTTLAWVRIEEEGIEGWGEACPFSVSDDCHQSLDDI
LMGLDVAKGILRRHSPWERQPIEAELLRAGIPSAARAAVDMALHDWMGKRLGRPLWQLWG
LDRSRIPPTTLTIGISTPQAARQRALAWMEQTQARAFKIKLGSDLGLMADQNMLIAVQEV
IPLGSLITVDANGAWTVEQTLSMSNWLAGQGVSYLEQPLERGQEAKLITLWHESKLPIFV
DESCFDSRDIPALVDRVHGINIKLMKCGGLSEAWRMIHTAKAYGLQVMLGCYSNTALGNT
AAAHLAPLVDYVDLDSHLNLIDDPFSGASVQEGCLIPTDRPGLGVELRE
Download sequence
Identical sequences Q2JT94
WP_011430782.1.8981 gi|86606608|ref|YP_475371.1| 321327.CYA_1963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]