SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321327.CYA_2197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  321327.CYA_2197
Domain Number - Region: 92-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000589
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 321327.CYA_2197
Sequence length 141
Comment (Cyanobacteria bacterium Yellowstone A-Prime)
Sequence
MVWPWVVFGLVLIAAELFLPELVAGPAGVAALGAALLAYWGWPVWAQFSAWIVLSLGLIV
LSRRLLPSTSTQLEDLLKESREARAVTAIPPGKRGRVSYLGSTWNAKCSVPDLEIQPGQE
LYVVDRQGNTLIVMPMQMLKS
Download sequence
Identical sequences A0A2G8NPP2 A0A2G8NSD2 A0A2G8P559 A0A2G8PFR7 A0A2G8PM44 A0A2G8PWE0 Q2JSN2
321327.CYA_2197 WP_011431010.1.8981 2010337915 gi|86606837|ref|YP_475600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]