SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321332.CYB_0177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321332.CYB_0177
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 321332.CYB_0177
Sequence length 115
Comment (Cyanobacteria bacterium Yellowstone B-Prime)
Sequence
MDVFIRLSHKGSPVTVVKLHSERLNAAIAREVRKELSQILTEKPGHFLLDLSQVSLIDSM
GLSVLVWAHRHCRTLGYQLKFCSLQEQVKLLFSITGLDAIYEIYPSVEKALESFP
Download sequence
Identical sequences Q2JPU9
321332.CYB_0177 WP_011431848.1.34384 gi|86607678|ref|YP_476440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]