SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100016
Domain Number - Region: 134-171
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000136
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100016
Sequence length 203
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLARTKVWEECHYDQLLMVGTTMILSVGNQVPMINKMIESYPRIIAP
SMENPNSQGVVNATPLQAIPPVVTYPSPMAYRQPKVPMNATINDSNEALLLNLTKKMEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDAECPSSHEKMEQCMYCGGNQLLVLTKT
TNNDTTNCMGCKSSINRKYGWME
Download sequence
Identical sequences A9U0T7
3218.JGI100016 jgi|Phypa1_1|100016|fgenesh1_pg.scaffold_406000020 XP_001784472.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]