SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100060
Domain Number - Region: 140-176
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100060
Sequence length 212
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTISASLNRAKVWEECHYDQFLIARATMIPVQGSYQNLTYNRSVDAYPRMLD
TRANSNANIQGSVNVTPLQAMPPNVTTTYAPYFSYQQQALAVAKLPIIPAPKDSNEALLL
NLTKKMEEMAVHMAKDKEKRKKPTNTRTNVWYSNCKGHGHLVTKCPSPSQMIDQCTFYER
KHLIANCWNLQRQQQFSNQIMIPPTHWDINQV
Download sequence
Identical sequences A9U0X6
XP_001784514.1.60028 3218.JGI100060 jgi|Phypa1_1|100060|fgenesh1_pg.scaffold_408000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]