SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100264
Domain Number - Region: 329-367
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.011
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100264
Sequence length 404
Comment (Physcomitrella patens)
Sequence
MRSNFENIQITTGLLSNMRLELVGRLNVVLITGLRFRFRLFRPLCHSGNVLLIKRSLKGS
LGGVSGEGSSKGQGMHMDPSIASMFQAFSLSMQQQQSNNRKEALATKALQAVVNKIDQFD
GRNISRYLRCYVHEMELNRVSEKKMVELFGLAMMPEIRHHIASITDCYGNSWEVFSHALK
DKYFLEDIDRVTKKLFLEWIERPNKNLQATELIKEFERQYSQLSKKLELLLEDKEEDEGL
TTKWKNVEDAVGLLTKRERRKDRSNISKTVQAPKAPVCTTPPTMPTVQPSTSLSKKADMG
MEKIIRGMRDLQIKLARLEENTSTNDSKNVSKQGYIQRCIWCDDASHTRKDCNEFNNTIQ
QGIICWKDGKIALKDREDLLQTNFGKGEMRALVQDYLKEHETVA
Download sequence
Identical sequences A9U192
3218.JGI100264 XP_001784623.1.60028 jgi|Phypa1_1|100264|fgenesh1_pg.scaffold_414000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]