SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100266
Domain Number - Region: 600-695
Classification Level Classification E-value
Superfamily Acid proteases 0.00244
Family Retroviral protease (retropepsin) 0.049
Further Details:      
 
Domain Number - Region: 269-307
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100266
Sequence length 1000
Comment (Physcomitrella patens)
Sequence
MENENKNLEGFLGGVSGGESSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNWVSEKKMVALFRLATIPEIRDHITSITDRYG
NSWEDFLHALKDEYFLEDADHVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEEL
TTKWKNVEDAVGLLTKKKRKKDRSNISKTVQAPKAPVLTTPPTMPTVQPSTSLSKKVDMD
MEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIR
QGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDAIGG
STETSEFWASAISTMQEGKLPREVLLRTAATIRGRTGWEDPFETLSVHAYIAKSQHEALM
VDKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYK
LLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMS
HAIDARICRAEEEVDIGYKQPTNEKNGYNQRVRFKDSSDKRMETLSHYTRKHWARATTEV
FVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEYGWAIRAANNTLGELYGACPD
VKIRIGDVATEQHFFVKDTTSYPLILGQPYITATRMETKVLDDGSAHARVRTKDGRKVVQ
FLTVLPNHERNRDRLREKPLPKIVEGFKDFGEIGALQDNERILGVYEENGLEDSLELITS
IGLGDNDKILEIHSREVYTMLESFQAPEVTVETRYKTADKKVKPVAGPLLEDSKEQMGEA
SKEASLRDPMSIGHQFTEETFEEFKIDSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGC
VDPNIITPMVIFTVPHVPWNLRPIPVPRAVLFSVPFQGTLFSVNGFLKETYRLGQKGLRQ
AVEEHPYRFMSKLIDCLTIDESPYYLLQPDARRVLEQEST
Download sequence
Identical sequences A9U194
jgi|Phypa1_1|100266|fgenesh1_pg.scaffold_414000012 XP_001784632.1.60028 3218.JGI100266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]