SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100460
Domain Number - Region: 242-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0141
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 
Domain Number - Region: 33-97
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0785
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100460
Sequence length 518
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSSSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVEKLTL
EPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIP
KQVQAPKAPVRTTPPTMPTVQPSTSLSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNL
KNVSKQGYVQRCIWCDDASHTRKDCNKFNNMIRQGIICWKDGKIALRDREDLLQTNFGKG
GMRALVQDYLKDHETVVRESASYGARVDDEIGGSTETSEFWTSAVSTMQEGKLPREALLR
TAATIRGRTGWEDPVESLLVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAR
EAALQELPVKDTSASLGEKTMETKDKGKSVAYKLLSDIEAATNWKGVLEERILNAKVEFT
LKEVLGIAKKEFHDVIIDSIKQKRQLMSKTGMSHAIDA
Download sequence
Identical sequences A9U1S5
jgi|Phypa1_1|100460|fgenesh1_pg.scaffold_424000022 3218.JGI100460 XP_001784802.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]