SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100553
Domain Number - Region: 634-726
Classification Level Classification E-value
Superfamily Acid proteases 0.003
Family Retroviral protease (retropepsin) 0.051
Further Details:      
 
Domain Number - Region: 487-591
Classification Level Classification E-value
Superfamily YwmB-like 0.0118
Family YwmB-like 0.036
Further Details:      
 
Domain Number - Region: 327-366
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100553
Sequence length 1056
Comment (Physcomitrella patens)
Sequence
MWSQLRGSILFQAVLFSVPFQGTLFSINGFLKGKNGGESLTARANFGSKLESFIFQQSKT
DRLCDYRRISILPSIARRPARSRAGKHDFWEKFLVVSLLKDKQQQNNDRKEALATKALQA
VVNKIDQFDGRNISRYLRCYVHEMELNRVSEKKIVELFGLATIQEIRDHITSITDRCGNS
WEDFLHALKDEYFLEDADHVEKLTLEPNKVDLFLQAADGKLQEKLEPLHEDKEEDEGLTT
KWKNVEDAVGLLTKKERRKDRSNIPKTIQAPKAPVRTTPPTMPTVQPSTSLSKKADMGME
EIIRGMRDLQIKLTRLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQG
IICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGST
ETIIIRGRTGWEDPVESLSVHAYIAKSQHEALMGEKRRGNFDDTREGNSFKRQTRGDKAR
EAASQELPVKDTSSSLGEKTRETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFT
LKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEKKVNIGYKQPTNEKNG
YNQRVHFKDSSDKGIETLCHYTRKHWARATTEVLVKVGDIEEPIVALVDHGSEINLMSKD
LYKKQKWPIDMEHGWAIQAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILG
QPYITATRMETKVLDDGSAYARVQSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGF
KDFGEEPLKERKRLYDIEGQLRKIGTLQDDERILGVYEENGLEDSLQLITSIGLGDNDKI
VEIHSREVYTMLESFQAPEVIIETRYKTADKKVKPLAGPLPEDSKELIEEASKESSLRDP
MSIEHQFTQETFEELKIGSDGSLLPEEITCFKKMLAKQGRSFAFESHEIRCVDPNIITPM
VIFTVPHVPWNLRPIPVPRHRPTPVQILSGQVQSLRYSQPGHTEMLYSIQITGVSRKRRI
NSHDGFEEPIGSNFENPIRVLLYNMRPELAGQPDAV
Download sequence
Identical sequences A9U210
3218.JGI100553 XP_001784890.1.60028 jgi|Phypa1_1|100553|fgenesh1_pg.scaffold_429000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]