SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100564
Domain Number - Region: 204-234
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0576
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 
Domain Number - Region: 68-167
Classification Level Classification E-value
Superfamily PH0156-like 0.0615
Family PH0156-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100564
Sequence length 593
Comment (Physcomitrella patens)
Sequence
MRPDLVGQLNVVPITRVLIPFQAVLFSVPFQGTLFSEKEPFERNSWKVFLHALKDEYFLE
DADRVTKKLFLEWIERPNKNLQAIELLREFERQYSQLSKVENLTFEPNKVDLFLQALDGE
LQEKLELLLEDKEEDEGLTTKWKNVEDAMGLLTKRERRKDRIQPSTSLSKKADMGMEEII
QGMRDLQIKLARLEENTSTNNLKNVSKQGYIQRCIWCDDASHTGKDCNEFNNMIRQRIIC
WKDRKIALKDREDLLQTNFGKGRMRALVQDYLKEHETAARESASYGARVDDDLGGSTETI
HAYIAKSQHETLMEEKRRENFDDTREGNSSRRQTRGDKAREAASQELPVKDTSALLEEKT
REIKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEILEIVKKEFYDVIIDSI
KRKRQLMDETGMSHAIDARIYKDEEEVDIGYNDKEMETLSHYTRKHWARATTKVLVKVGD
IEEPIVALVNHGFEINLMSKDLYKKQKWPIDMEHRWAIRAANNTRGELYGTCPDVKIRIG
DVAMEQHFFVQDTTSYPLILGQPYITATRMETKVLDDGSAYAKIRSEDGRKVV
Download sequence
Identical sequences A9U221
XP_001784910.1.60028 3218.JGI100564 jgi|Phypa1_1|100564|fgenesh1_pg.scaffold_429000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]