SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100630
Domain Number - Region: 252-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0201
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100630
Sequence length 700
Comment (Physcomitrella patens)
Sequence
MLHSIPITGVNRKGKDQFTRRAVLFSVPFQGTLFSVKGSLKGFLEGVSGGDSSKGQGMHM
DPSIASIFQAFSLSMQQQQSNDQKEALATKALQAVVNKIDQFDGRNISRELLREFERQYS
QLSKVEKLTLEPNKVDLFLQAADGELQGKLELLLEDKEEDEGLTTKWKNVKDAVGLLTKK
ERKKDRSNILKTVQVPKALVRTTPPTMPTVQPSTSLSKKADMEMEEIIRGMRDLQIKLAR
LEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDRE
DLLQTNFGKGGMRALVQDYLKEHETAIRESASYGARVDDEIGRSMETSEFWASAVSTMQE
GKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEKKRRGNFDDTREGNSS
KRQTRGDKAREAASQELPVKDTSTSLGQKTKEIKDKGKSIAYKLLSDIEAATNLKGVLEE
RILNAKVEFTLKKVLRIAKKEFQDVIIDSIKQKIIYRDEEEVDIGYKQPTNEKNGYNQRV
RFEDFSDKEMETLSHYTRKHWARATIEVLVKVGDIEEPIVALVDHANNTWDELYGACPDV
KIRIGDVAMEQHFFVQDTTSYPLILRQPYITATQMETKVLDDGSAYARLGTLQDDERILG
VYEENGLEDSLELITSIGLRDNDKIIEIHSREVYTILESF
Download sequence
Identical sequences A9U286
XP_001784965.1.60028 3218.JGI100630 jgi|Phypa1_1|100630|fgenesh1_pg.scaffold_432000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]