SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100672 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI100672
Domain Number 1 Region: 186-228
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000142
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100672
Sequence length 367
Comment (Physcomitrella patens)
Sequence
MASGGVPSVPTGPPVSPIGPIRPAVPIFVPMGQVGDRTTSIAPLPIFSGWPVALSLVRAK
VWEECHYDRILNSNPTLIPTQGSSKFPNWSNLANSITGAMAPATHSTIPIQGVLNPVPLQ
AVPSPTASTYPQFVLYQPPSVNTQELPMLPGSKETNETLLLNLTKKMEELAVNMAKEKEK
RPKQTNFRANVWCTNCKGQGHMVQDCPSPRNMKIQCMNCGGKHPTNNCWYLSNPHFNNTM
SPPMSWDVQIQSSQEDTNPVLQDSPVNHIQVVQAVQTRGQRNLQSILKKDKIIEEQPEPI
QKKATIFAKPANQLRPVLVPTDSFNSTPIAPGGLNSQCPVQSIPIETVPTLSRIPISAPI
EPPNSVS
Download sequence
Identical sequences A9U2C4
XP_001785002.1.60028 jgi|Phypa1_1|100672|fgenesh1_pg.scaffold_434000016 3218.JGI100672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]