SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI100678
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100678
Sequence length 156
Comment (Physcomitrella patens)
Sequence
MEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQVLGKCTFCGGKHLTA
NCWNLQRQQQFSNPTMIPPTPWDVNQVQIGNTFGWHGNRSNRQNRAVNHFQNSTYSEGFV
SNPRNYDPESRKNGGNKSRTSRLSSKSGGMCPYRSY
Download sequence
Identical sequences A9U2C9
XP_001785014.1.60028 3218.JGI100678 jgi|Phypa1_1|100678|fgenesh1_pg.scaffold_435000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]