SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI100856
Domain Number - Region: 384-433
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100856
Sequence length 954
Comment (Physcomitrella patens)
Sequence
MHKATRSQKLVLTPPLGKPNQPQGIPSKLREPLHLDNQLEFSEDLDNPIGDFIEVILDQS
ELTHNSTTNYSRELENPISILSPNQPRPRNLLIPMASGGASTGGGGLLGIPINPLVQPWR
LPIVVLGGLPIASIPPHLPLFKGTRDEYPSAHVERFIEILTTCLITDVRYFLVWFPTTLK
EGAYEWYRNHPANTFVDWDMLQRAFLEEFRPEVVTRFVSTLLTDDTLKNFFIQGFSKETT
IREILNSRPQTLADAKRAARVIEQINKEHDRIWRKEDQNIPNFIPIHAQGTGSSLNSNQP
SIAMPLHSMQQYPTLLDTRLPAALPVLTFPEKNWREEMKREMQSVQQGFQDQISQQMKLM
TDQMAALARIQNFNPPLPPIESENHSSGLWCTRCGQPGHTFQFCNENPSCWLESQVVCGN
CGGNHPTNKCRKRDKVFPLQPPPGNYVQQGYDNRRGERQPPHNNTLQPPNLYYDYNNNRQ
NHHPPTRLQINRGFLPMNQNQNRGPFIQNQANVGQGSQDARFINQTNSGMIDRQSSTSSI
VIQPIPPESNLIRHELLQPKMLNPPMKPALAIMTRSRAANMPSVLEEEESLTESPPRLSE
LEDIARKTKETINNRGEETLEFDPLIGDLPFQLRDHDGEPSIKPDTCDWKGPAIPKLELI
QPSKTQAQSELGAYDLWADLGRIKADITITQFLEISPIARKILKLETSIKCRRKAKVKVA
ARMQTSRKLVDMPISVTTPNIQRQAQMKKPGTGSEPQLLDITHHVSGCIGPGLYDWKDDG
QFAQWLEDNPHLDLEHTTCYIEASMRELEDGYPGLAIVIDDIIYEDVCHLTIDGTQFEDI
DTLLKEKDLLPPLHVRKINRGLDIGTDLSIYPPIPSDWYRGPTKLDYAKPSDWKSLDVSL
DGEDPKPIKIGSQLTIELLGVVVPEPEFPIDAEALAKLLRIRSKSLDLPLRDKS
Download sequence
Identical sequences A9U2L9
XP_001785102.1.60028 3218.JGI100856 jgi|Phypa1_1|100856|fgenesh1_pg.scaffold_443000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]