SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI100886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI100886
Domain Number 1 Region: 143-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000201
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI100886
Sequence length 645
Comment (Physcomitrella patens)
Sequence
MQKMIRNESSVVFFEIMRGIGGHTESQNIPPTLDNAISSAEIYETAYYKKESHGREKKCS
KKKKRRSNSSSSSSASSDSSSSSSSSSKEDTRKASYKRKEKRKKDRKKEETTPRPSTPKK
EDPMDTLRKKMAELKIQVVGTQPSRPKPSYQRPNIWCTICQKPGHTASECYSNRPSYPVQ
QMEWVPAWDYYEGYQQEDQVYVGEEVPTHTPIPPVMIPRYVPREYVQNLPHRTMVPHNSP
PVANYDQRPAQQKHAVRFSTAPPVTISKVDTPVNLVSWDHTKPSKDLEMEWPEEFRDDLP
IEVLKVETRYTKKQKKKGTSSSSSESPPPKKKSERKNIEISTPSKKETPKQATASPHEDK
QPTAFPADIREEVQELIHKEVQDELAPVVPEKKVEVPSTKTIQKKQVVPNYDVVEDLKGQ
KANVTFEQLLADSKPYKKLVASSLRHTNATRKRILPTVFHVEQEDLGSPEIDVEIAGCIL
KEVPDLRGPAQKQIIVSWKKVPHLGETPPIDQGYTSETSETSSTDLKDPYDVSYLTCYLV
DEDEEDSRNEDPESEKNLDLARLGISSTSHVTKTVIRKWQQIHEDPFPEEYYQDYLRDGE
GTFDPRKNETLEGERAEEDSGHSRRQKLYSEGSRTCTISESRRCE
Download sequence
Identical sequences A9U2P8
XP_001785129.1.60028 jgi|Phypa1_1|100886|fgenesh1_pg.scaffold_445000007 3218.JGI100886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]