SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI101135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI101135
Domain Number - Region: 209-249
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00663
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI101135
Sequence length 328
Comment (Physcomitrella patens)
Sequence
MVELLGLATIPEIRNHITSITDRYGNSWEVFSHALKDEYFLEDTNRITKKLFLEWIERPN
KNLQVTELLKKFERQNSQLSKVEKLTLEPNKVHLFLQATDRELQGKLELLLEDKKGDEGL
TTKWKNVEDAVGLLTKRERRKDRSNIPKTIQAPKAPVRITPPTMPTVQPSTSLSKKADMG
MEEIIRGMRDLQIKLARLKENTFINNLKNVSKQGYVQRCIWCDDASHTKKDCNEFNNMIW
QGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETVASYGARVDDEIGGRTET
SEFWASAVSTMQEGKLPREALLRTAATI
Download sequence
Identical sequences A9U322
XP_001785257.1.60028 3218.JGI101135 jgi|Phypa1_1|101135|fgenesh1_pg.scaffold_455000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]