SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI101193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI101193
Domain Number 1 Region: 158-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI101193
Sequence length 207
Comment (Physcomitrella patens)
Sequence
MATGGSVVPIAVQMGDVSNRTMSMAPLPTLRDFLGADLDQHLSQFLTPFQGSYQNPTWNG
SVGAYPWMLDTKTNSSANIQGPINVIPLQAMPPNVTTTYTPYFSYQQQALTVPELSIISI
PKDSNEALLLNLTKKMEEIAVNMAVNIAKDKEKRQKSTNTRTNVWCNNCKGHGHLITKCP
SPSQMMGQCTFCGGKYLTASCWNLQRQ
Download sequence
Identical sequences A9U371
XP_001785305.1.60028 3218.JGI101193 jgi|Phypa1_1|101193|fgenesh1_pg.scaffold_459000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]