SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI101413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI101413
Domain Number - Region: 104-149
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI101413
Sequence length 702
Comment (Physcomitrella patens)
Sequence
MIPSQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKSI
PTKELTNELVSRDPNESLLLTLTKKMSELAVNLAKDKEKRHKPTNMRPNVWCSNCKEQDH
LVTECSSPPQMMVQCTFCGSKHTTANCWNLRKQQQVGQQTMSQPTSWNMQTSQPAEDKGP
VQWDSPVHHIEVVNAVLTKGQQKGKNPIQDLDDPIEVTTVAPSTRRTEPISVLGRIPILS
PQQDEEPNSILRANFSGTSRSIPNDHVPIPAQPNISSYPLKEPLVVEESTKRKELLPNRV
KTKPMKRKRALGSFIMSREKVKRASEKEEEGRRVRSRSNMDELSLCILTNMEPIQLEICW
NATREKDFGSAQLYPFLRVAENLPSIDVEILEEYLTNYDLEDGSSVVKGMTLRIDENTLH
KALQLPIVELAVGVEESSDFNLGSYFKGGMTSLERNQGWRTADALTPKLMEWMRFIQKRL
GLNRHMTYMAKRLLYATIGSFEGMSTIIYELSQSLLEKGKTIAAPVLPKPRSNLLALLWG
PGETSQQAGEPISVRERGPMAQRDNRPVDIQHRTPEENSVKERFLTKMATLEQEKKTMSD
QFRVKTEEMQGEINTLKEVAKKLVEELVSVRWPQGSIDGSIGKLEQKVKQQQHQLEAKDT
RILQLESQVRELGALNEDLTARLNIVPINVSDGKVEEVTLEL
Download sequence
Identical sequences A9U3M7
3218.JGI101413 jgi|Phypa1_1|101413|fgenesh1_pg.scaffold_473000004 XP_001785461.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]