SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI101564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI101564
Domain Number 1 Region: 162-209
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000011
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI101564
Sequence length 288
Comment (Physcomitrella patens)
Sequence
MTTGGPAVPIAVQMGTVSDRTTSVAPLPTFRGFPGADPDQYLSQFLTACVANNGRTEDIC
NYQYPALNGSVGSYPQMIETVAQSSANTQGPVNVTPLQALPPQVTTAYAPYFPYQTHEST
LAEKQIISASKDSNEALLLNLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHL
VTECPSPSQVLGKCTFCGGKHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTGNTFRWH
GNRSNRQNRAVNHFQNSTYSEGFVSNPRNYGKEQHGYQPYAPSMPLNQ
Download sequence
Identical sequences A9U3X0
XP_001785553.1.60028 jgi|Phypa1_1|101564|fgenesh1_pg.scaffold_482000007 3218.JGI101564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]