SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102003
Domain Number - Region: 261-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00384
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102003
Sequence length 301
Comment (Physcomitrella patens)
Sequence
MVNQVQTLKGRLEILTKEETDKVKEEIIVSLCVQILEVEMIHSGEKLPRTLARNFVNISV
EILRPLTEREGGVEEFGTPLGIFLVGGTAETSNSGSSDWHKLVANKDNYVVFQNLTFSPA
IQPIKLFAKNNSKSRSTESSKIRIRERRDYFKMEFSGTRNSMASGGPAVPIAVQMGAESY
MGRNDYGTIPQGIVDAVPLQAVPPSSSHSYAPYSAYQKPTPTKELPNALVSRDPNESLLL
TLTKKMDELAMNLTKDKEKSNCKGQGHLVTECPSPLQMTVQCTFCGGKHITTNYWNLRKQ
Q
Download sequence
Identical sequences A9U4J7
XP_001785780.1.60028 3218.JGI102003 jgi|Phypa1_1|102003|fgenesh1_pg.scaffold_519000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]