SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102012
Domain Number - Region: 218-248
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0141
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102012
Sequence length 390
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATISEIRDYITSITDRYRNSWEDFSHALKDEYLEDANRVTKKL
FLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLL
EDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRNNIPKTVQAPKAPVRTTPPTMPTVQLLT
SLSKKADMGMEEIIQGMRDLQIKLARLEENTSINNSNNVSKQGYVQRCIWCDDASHTRKD
CNEFNNMIRQGIICWKDEKIALKDREDLLQTNFGKGGMRALVQDYLKGYETVARESASYG
ARVDDEIGGSTETSEFWASAVSTMQEEKLPREALLRTAATIRGRTGWEDPVESLSVHAYI
AKSQHEALMEEKRRGNFDDTRGGNSSKRQT
Download sequence
Identical sequences A9U4K6
XP_001785793.1.60028 jgi|Phypa1_1|102012|fgenesh1_pg.scaffold_520000005 3218.JGI102012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]