SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102013
Domain Number - Region: 194-224
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0181
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 33-136
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.085
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102013
Sequence length 410
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPEIKDHITSITDRCGNSWVDFSHALKDEYFLEDADRVTKK
LFLGWIEPPNKNLQATELLKEFERQYSQLSKVEKLTLEPNKVDLFLRATDGELQEKLEPL
LEERRKDRSNISKQVQAPKAPVRTTPPTMPTVQPSTSLSKKTDMGMEEIIQGMRDLQIKL
ARLEENTSINNSNNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDEKIALKD
REDLLQTNFGKGGMRALVQDYLKGYETVARESASYGARVDDEIGGSTETSEFWASAVSTM
QEEKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGN
SFKRQTRGDKAREATSQELPYAPADCNGVTEPDHLVFVLELVDALNIRGN
Download sequence
Identical sequences A9U4K7
3218.JGI102013 jgi|Phypa1_1|102013|fgenesh1_pg.scaffold_520000006 XP_001785789.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]