SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102230
Domain Number - Region: 108-133
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102230
Sequence length 622
Comment (Physcomitrella patens)
Sequence
MRLELAGQPNADPITGTSRERCLRQMDLLKVFEDHGGFFDKDREELASCFGRGKKTENWI
FFFFIGLEKNKSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNISKQGYVQRCIWC
DDASHTRKNCNEFNNMIRQGIIYWKDGKIALKNREDLLQTNFGKGRMKTLVQDYLKEHET
AARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTPATIRSRTGWEDLV
ESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSSS
LGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLEIAKKEFHNQ
STNEKNGYNQRVRFEDSSDKEMETLSHYTWKHWARATTEVLVKVEDIEEPIVTLVDHGSE
INLMSKDLYKKQKWPIVMEHGWVIRAANNTRGELYGASTRMETKVLDDGSTYAMVRSEDG
RKAVQFLTVPPNHEQNQDRLREKPLPKIVEGFKDFGEVYTMLESFQAPEVTVETRYKTAD
KKVKPIVRPLPEDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSLLPKEITC
FKKMLAKQGDEDELDKDVEDIF
Download sequence
Identical sequences A9U4Z3
jgi|Phypa1_1|102230|fgenesh1_pg.scaffold_550000002 XP_001785929.1.60028 3218.JGI102230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]