SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102539
Domain Number - Region: 24-103
Classification Level Classification E-value
Superfamily Acid proteases 0.00183
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102539
Sequence length 174
Comment (Physcomitrella patens)
Sequence
METLSHYTQKHWARAITEVLIKVRDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEYG
WAIRAANNTRGKLYGACPNVKIWIGNVAIEQHFFIQDTTSYPLILAQPYIMAIRMETKVF
NDDSAYARVRSEDERKAKIFLTVPPNHERNRDRLREKPLPRIVEGFKDFGEVRL
Download sequence
Identical sequences A9SK41
jgi|Phypa1_1|102539|fgenesh1_pg.scaffold_623000001 jgi|Phypa1_1|80481|fgenesh1_pg.scaffold_87000004 XP_001766781.1.60028 XP_001786041.1.60028 3218.JGI102539 3218.JGI80481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]