SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102614
Domain Number - Region: 379-401
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102614
Sequence length 412
Comment (Physcomitrella patens)
Sequence
MTPELVERLNVVPITGISILFQAVLFSVPFQGTLFLKKEPFKRQKMEEKALTAEPILDPR
RKIEEIQRLGFKRGGELSQWIQGREYKAVSEISKLGCSRFSVTSRDLLVGAKRILARSLG
RIFGEGSSKGQGMYMDPSIASMFQAFSLSMQQQQSNDRKEALATKALQAMVIKIDQFDGR
NISRYLRCYVREMELNQVSEKKMVELFGLAMISEIRDHITSIMDHYRNSWEVFSHALKDE
YFLEDVDHVEKLTLEPNKVDLFLQAADVELQGKLELLLEDKEEDEGLTTKWKNVEDAVGL
LTKRERRNDRSNIPKTVQAPKAPICTTPPTMPTVQPSTSLSKKADMEMEEIIRGMRDLQI
KLARLEENTSTNNLKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIRQGIIC
Download sequence
Identical sequences A9U5E3
jgi|Phypa1_1|102614|fgenesh1_pg.scaffold_650000002 3218.JGI102614 XP_001786078.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]