SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102671
Domain Number - Region: 340-424
Classification Level Classification E-value
Superfamily Acid proteases 0.00103
Family Retroviral protease (retropepsin) 0.066
Further Details:      
 
Domain Number - Region: 31-71
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00994
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102671
Sequence length 485
Comment (Physcomitrella patens)
Sequence
MDMEEIIRGMRDLQIKLARVEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNM
IRQGIICWKYGKITLKNREDLLQTNFGKGGMRALVQDYLKEHETVARESASNGTRVDDEI
GGSTKTSEFWASAVSTMQEGKLPREALLRTATRIRGRTGWEDPVESLSVHAYIAKSQHEA
LMEEKRRRNFDDMREGNSSKRQTRGDKARERASQELRVKDTSALLEEKTRETKDKGKSIA
YKLLSDIEAGTNLKGVLEERILNAKVEYTLKEVLEIAKKEFHDVIIDSIKRKRQLMGETR
MSHAIDARIYKDEEEDDMGYKQPTNEKNGYNQRVGDIEEPIVALVDHGSEINLMSKDLYK
KQKWPIDMEHRWAIRAANNTRGELYGTCPDVKIRIGDVATEQHFFVQDTTSYPLILGQPY
ITATQMETKVLDDGFAYGRVRSEDGRKVVQFLTVPPNHERNRDRLREKPLPKIVEGFKDF
GEVPL
Download sequence
Identical sequences A9U5I4
3218.JGI102671 XP_001786119.1.60028 jgi|Phypa1_1|102671|fgenesh1_pg.scaffold_683000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]