SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102673
Domain Number - Region: 342-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102673
Sequence length 372
Comment (Physcomitrella patens)
Sequence
MGHTEMLHLIPITGVSWKEKDQFNDGYLEYWVQRPTPVQILSGQVQSPRYSQPGHTEMLR
SILITGVSRKRKDQFTRQRPTGWDKKNFDEQSKRHPYRFMVYSCSRLYSNSQKLIDCLTI
GESLYYLLQPNVRRVLEQESTNSKAMIERKLWQPKHCKQWSIKLIKLMEGIFQDVDRVTK
KLFLEWIERHNKNLQATELLREFERQYSQLSKVEKLTLESNKVDLFLQAADGELQEKLEL
LLEDKEEDEGLTTKWKNIEDTVGLLTKRERRKDRSNIPKTVQAPKAPVCTTLPTMPTVQP
LTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDASHTR
KDCNEFNNMIRQ
Download sequence
Identical sequences A9U5I7
3218.JGI102673 jgi|Phypa1_1|102673|fgenesh1_pg.scaffold_686000002 XP_001786121.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]